Identifiers and Description

Gene Model Identifier

TTHERM_00384800

Standard Name

NOPP52 (Nucleolar PhosphoProtein )

Aliases

PreTt24772 | 41.m00179

Description

Nucleolar phosphoprotein; domain structure similar to vertebrate nucleolin and yeast NSR1; localized to macronuclear nucleoli where it is closely associated with rDNA; in vitro substrate for casein kinase II

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

  • ( PF07382 ) Histone H1-like nucleoprotein HC2
  • ( TIGR01622 ) splicing factor, CC1-like family
  • ( PF08186 ) Wound-inducible basic protein family
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00384800

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
SGDYNL175C7.002638123733849e-21NOP13 Nucleolar protein found
in preribosomal complexes; con
tains an RNA recognition motif
(RRM)
Tetrahymena borealisEI9_01741.12.9992476920535046e-16hypothetical protein (295 aa)
Stentor CoeruleusSteCoe_351420.00000000000003442477108469977
WormBaseWBGene000039020.00000000000009996062864481225locus:pab-1 status:Partially
_confirmed UniProt:Q7K798
protein_id:CAE54916.1
OxytrichaContig11442.0.g160.0000000000002999981760818895RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)
DictyBaseDDB_G02754590.0000000020002373268528243DDB_G0275459 on chromosome: 2
position 6113524 to 6114624

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:11381093: Savino TM, Gébrane-Younès J, De Mey J, Sibarita JB, Hernandez-Verdun D (2001) Nucleolar assembly of the rRNA processing machinery in living cells. The Journal of cell biology 153(5):1097-110
  2. Ref:9109258: Smothers JF, Madireddi MT, Warner FD, Allis CD (1997) Programmed DNA degradation and nucleolar biogenesis occur in distinct organelles during macronuclear development in Tetrahymena. The Journal of eukaryotic microbiology 44(2):79-88
  3. Ref:9017598: McGrath KE, Smothers JF, Dadd CA, Madireddi MT, Gorovsky MA, Allis CD (1997) An abundant nucleolar phosphoprotein is associated with ribosomal DNA in Tetrahymena macronuclei. Molecular biology of the cell 8(1):97-108

Sequences

>TTHERM_00384800(coding)
ATGTCCAAATAAGTTAAGAAGGGTCAAGTTGAAAAGAAGATTAAGGCTGAAGAAGAAAAG
AAGAAGGTTGTCTAACAATCCTCCGATGATAGTGACGATTCTTCCAGCGAAGATGAAAAG
CCTGTTGTCAATAACAAGAAGAACCAAAAGGTTTAAGAAAAGGCTGCTGAAAAGGTTACC
AAGGCTAAGAAGCAAGTTTCTGAATCTTCTGATGACAGTGAATCTGAAGAAGAAAAGCCT
GCCCCCAAGAAGGCTGTCGCTGCTAAGACTGCTCCTGTTGCCAAGAAGGCTGTTGCCAAG
AAGGAATCCTCTGATTCTGATGACAGTGAATCTGAAGAAGAAAAGCCTGCCCCCAAGAAG
GCTGTCGCTGCTAAGACTGCTCCTGTTGCCAAGAAGGCTGTTGCCAAGAAGGAATCCTCT
GATTCTGATGACAGTGAATCTGAAGAAGAAAAGCCTGCCCCCAAGAAGGCTGTCGCTGCT
AAGACTGCTCCTGCTGCCAAGAAGGCTGTTGCCAAGAAGGAATCCTCTGATTCTGATGAC
AGTGAATCTGAAGAACAAAAGCCTGCCCCCAAGAAGGCTGCCGTTAAACCCGCTGCCAAG
AAGTAAGAATCTGAAGATGAAGACAGTGATGAATCAGAAGAATAAAAGCCTGCTACCAAG
AAGGCTGAAAAGATGTAAGTCGAAGAAGAATCTTCTGAAGAATAAAAGCCTATTAAATAA
GACCAACCTATCCAAAAGGCCTAAAACGGTAATGCCAACGGTAAATAAGGTGGTGACAAG
TTCTCTAATGAAGTTATCGTTAAGGGTTTGAGCTTTGATGCTGATGAAAACGATATTGGT
AACTTCTTAGACGAAAACTGCGGTTCCGTTGCTAGAGTTAACCTCTTAAAGAACGAATAA
GGACGTTCTAAGGGTATTGCCTTCGTCAGCTTTGAAACTGAAGAAGGTTGCAACAAGGCT
GTTGAAATGAGCAACTCTGAATTCATGGGTAGATATCTTATTATTGAAAAGACCAAGCCC
AAGACTGAAAGACCTGCTCACTTACCTGTTGATGAAGACTCCAAGACTATCTTTGTTGGT
AACCTCTCTTTCAGAACCGACAAGGAAACTCTTAAGAAGTTCTTCGCCTCTTGCGGTAAG
GTTGCTGATGCTCGTATCGCTGAAGCTGATGGAAAGAGCAGAGGTTTCGGTCACGTTGAA
TTCGAAGAAAGATCCGGTGTTGAAAATGCTTTAAAGAAGGTTGGTGAATAAATCGACGGA
AGACCCATCAAGGTTGATGTCGCTGCTTCCAGAGGTAAACGTGAAGGTTTCAACAGATCC
TAAGGAAACTTCAATAACAACAGAGGTGGTCCCCGTGGTGGTAACAACTCTTTTGCTAAC
GAAAGAAAGGGTGCCATTACTTAATTCTAAGGAAAAATCCAATCTCTCTGA


>TTHERM_00384800(protein)
MSKQVKKGQVEKKIKAEEEKKKVVQQSSDDSDDSSSEDEKPVVNNKKNQKVQEKAAEKVT
KAKKQVSESSDDSESEEEKPAPKKAVAAKTAPVAKKAVAKKESSDSDDSESEEEKPAPKK
AVAAKTAPVAKKAVAKKESSDSDDSESEEEKPAPKKAVAAKTAPAAKKAVAKKESSDSDD
SESEEQKPAPKKAAVKPAAKKQESEDEDSDESEEQKPATKKAEKMQVEEESSEEQKPIKQ
DQPIQKAQNGNANGKQGGDKFSNEVIVKGLSFDADENDIGNFLDENCGSVARVNLLKNEQ
GRSKGIAFVSFETEEGCNKAVEMSNSEFMGRYLIIEKTKPKTERPAHLPVDEDSKTIFVG
NLSFRTDKETLKKFFASCGKVADARIAEADGKSRGFGHVEFEERSGVENALKKVGEQIDG
RPIKVDVAASRGKREGFNRSQGNFNNNRGGPRGGNNSFANERKGAITQFQGKIQSL


>TTHERM_00384800(gene)
ATGTCCAAATAAGTTGTAAGAATTTTATTCATAATTTTTTAGCTATTATAAAACTAATTC
ACTTTATAAATCATTTTATTAATCTATTCTTTAATCATTATAGAAGAAGGGTCAAGTTGA
AAAGAAGATTAAGGCTGAAGAAGAAAAGAAGAAGGTTGTCTAACAATCCTCCGATGATAG
TGACGATTCTTCCAGCGAAGATGAAAAGCCTGTTGTCAATAACAAGAAGAACCAAAAGGT
TTAAGAAAAGGCTGCTGAAAAGGTTACCAAGGCTAAGAAGCAAGTTTCTGAATCTTCTGA
TGACAGTGAATCTGAAGAAGAAAAGCCTGCCCCCAAGAAGGCTGTCGCTGCTAAGACTGC
TCCTGTTGCCAAGAAGGCTGTTGCCAAGAAGGAATCCTCTGATTCTGATGACAGTGAATC
TGAAGAAGAAAAGCCTGCCCCCAAGAAGGCTGTCGCTGCTAAGACTGCTCCTGTTGCCAA
GAAGGCTGTTGCCAAGAAGGAATCCTCTGATTCTGATGACAGTGAATCTGAAGAAGAAAA
GCCTGCCCCCAAGAAGGCTGTCGCTGCTAAGACTGCTCCTGCTGCCAAGAAGGCTGTTGC
CAAGAAGGAATCCTCTGATTCTGATGACAGTGAATCTGAAGAACAAAAGCCTGCCCCCAA
GAAGGCTGCCGTTAAACCCGCTGCCAAGAAGTAAGAATCTGAAGATGAAGACAGTGATGA
ATCAGAAGAATAAAAGCCTGCTACCAAGAAGGCTGAAAAGATGTAAGTCGAAGAAGAATC
TTCTGAAGAATAAAAGCCTATTAAATAAGACCAACCTATCCAAAAGGCCTAAAACGGTAA
TGCCAACGGTAAATAAGGTGGTGACAAGTTCTCTAATGAAGTTATCGTTAAGGGTTTGAG
CTTTGATGCTGATGAAAACGATATTGGTAACTTCTTAGACGAAAACTGCGGTTCCGTTGC
TAGAGTTAACCTCTTAAAGAACGAATAAGGACGTTCTAAGGGTATTGCCTTCGTCAGCTT
TGAAACTGAAGAAGGTTGCAACAAGGCTGTTGAAATGAGCAACTCTGAATTCATGGGTAG
ATATCTTATTATTGAAAAGACCAAGCCCAAGACTGAAAGACCTGCTCACTTACCTGTTGA
TGAAGACTCCAAGACTATCTTTGTTGGTAACCTCTCTTTCAGAACCGACAAGGAAACTCT
TAAGAAGTTCTTCGCCTCTTGCGGTAAGGTTGCTGATGCTCGTATCGCTGAAGCTGATGG
AAAGGTAACTAACCAATTTAAATTTATATCTAATATAATTTTTATCTGAAAATGTGATGG
GGTATAGCTTGCTTATTATTTATTTTAGGGAAATATTTTATTTGAGATTAATTAAGGGAT
AAAAGTTATAATTAGGAACATACTATACTTATTAGAGAGTTAAGTAGGAGTTTACAATAT
TAAGATATAAAAATAATAAATTACAAATAAAAAAAAAATAAATTGATTAATAAATAAATA
AATTAATCAATCAATTAATAATAGTATCTTCGTTCGTTAATAGACAAACACAATAAAAAA
TAAATAAAATTTCCCAAATTAATTAATTAATCAATTAGTAATGAATAAGTAACATTGATT
ATATTTCCCTAAATAAATCACTAAGATAATAAATTAATTAATTAATTACATGATAACTTT
TAACTTTATTCAAATATTAAATATAATTTTTAAAAATTTAGAGCAGAGGTTTCGGTCACG
TTGAATTCGAAGAAAGATCCGGTGTTGAAAATGCTTTAAAGAAGGTTGGTGAATAAATCG
ACGGAAGACCCATCAAGGTTGATGTCGCTGCTTCCAGAGGTAAACGTGAAGGTTTCAACA
GATCCTAAGGAAACTTCAATAACAACAGAGGTGGTCCCCGTGGTGGTAACAACTCTTTTG
CTAACGAAAGAAAGGGTGCCATTACTTAATTCTAAGGAAAAATCCAATCTCTCTGA