Identifiers and Description

Gene Model Identifier

TTHERM_00467910

Standard Name

NaKa1

Aliases

PreTt18692 | 55.m00247 | 3710.m00096

Description

Orthologue of S. cerevisiae Rrb1 (Ribosome assembly protein). Rrb1 ortholog in humans is known as GRWD1. NaKa-1 contains WD-40 repeats with domain architecture similar to RebL1 and Wdc1 in Tetrahymena (Nabeel-Shah et al. 2021).

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00400 ) WD domain, G-beta repeat

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00467910

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15704.19.997093137033517e-262hypothetical protein (586 aa)
OxytrichaContig21203.0.g383.999284652801983e-113WD domain, G-beta repeat
DictyBaseDDB_G02915669.001701800865775e-93grwd1 on chromosome: 6 positio
n 556339 to 557876
SGDYMR131C2.0009381340492598e-66RRB1 Essential nuclear protein
involved in early steps of ri
bosome biogenesis; physically
interacts with the ribosomal p
rotein Rpl3p
WormBaseWBGene000218991.9997677415930956e-65status:Confirmed UniProt:Q9N
393 protein_id:CCD69848.1
Stentor CoeruleusSteCoe_76448.194012623990515e-40

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:34086947: Nabeel-Shah S, Garg J, Saettone A, Ashraf K, Lee H, Wahab S, Ahmed N, Fine J, Derynck J, Pu S, Ponce M, Marcon E, Zhang Z, Greenblatt JF, Pearlman RE, Lambert JP, Fillingham J (2021) Functional characterization of RebL1 highlights the evolutionary conservation of oncogenic activities of the RBBP4/7 orthologue in Tetrahymena thermophila. Nucleic acids research ( ):

Sequences

>TTHERM_00467910(coding)
ATGAGTGACAATAAAAAGATAAGTTAAAAGAGAAAGCTTGAAACTGCTGAAGATGTTTCA
CTTAATATTAAAGAACAAAACTAGAAAAAAAATCCTAATAAGAAGAAAGGGGATTAAGCA
GTAGTTGACGAATTCGAAAAAAATGAAAATTTTGAAGAGGAAGAAGGATCTGAATTAGAA
TTTGAAGATTGTGAAGATGATATAGATGATGAATATGTTGATGAAAAGACATACAAAAAG
ATTATGTAAGGAAATTTCTAAGAAGATGAAGAGGAATGGGAAGACGATGGAGATGATGAC
GATGATGAAAATGAAGAAATTGGTAATGAAGAAGAAAAATAAGACATAAATGCAAAGAAG
AGAAATAAAAAAAATAAAAACTAAAAAGTTGAATTTATTGATGTTTAATAAAAGCCTTTC
ATGGGTACTGAAAAGAATTTAGAAGAAGATGAAATTCTAGATTTCGATAATAAGGCATAC
GAAATGCTTCATAGAGCTAACACTGAATGGCCTTGCTTGTCATGTGATTTTGTAACTGGA
GAACCTCATAATATTAATAACCCTGGCTTCTAAGAAATGAAAAAGTATCCTTATGATGTT
TATGTAGTAGCAGGTACCTAAAGCAAGTAATAAAATTTCATATACTTAATGAGATGGTCC
AAATTACATAAGACAAAATATGACGATGATTCTGATTACTAAGATGATGATGAAGATGAT
ATCAATAACGACGATGAACCTGAGCTTGCTTTACAAAGTATTTAAATTAAAGACCCTGTT
AATCGTATTAGAGCTATGTAAAACTCACCACTTGTTGCATATTGGACTGAAAATGGAGAT
GTCACTATTGCTGATTTGTCATCTCGTTATGATATACTTAACTAATGGGATCCAAAAATT
TTAGCTTCAAAACCCAAAAACAATCCTAAAGACAAAGTTTTTACCAAAACTTTCCATAAT
TAAGTTGAAGGTTTTGCTCTTGATTGGAGTCCTATTAAGCCTGGCAGATTGGCTTCAGGT
AGCTGTGATGGCAAAATATTTATTTATAATGCTAAGAATTTTGCCTTTAACGATTGGGAG
AGAGATCAACACCCTTATGTTTACCACGAAGGATCTGTCGAAGATCTTTAGTTCTCTCCT
GTTGAAGAATACAGTCTTGCTTCATGTTCAACTGATGGAACAATTAGAGTAGTTGATTTA
AGAGTAGGTAATAAAAAATAAGCTCAATTACTTGTTAAAGCCCACGAATGTGATGTAAAT
GTTATTTCTTGGAACCACAAGAATCCTTTCCTCATAGCATCAGGAGCAGATGATGGTTGC
TTTAAAGTTTGGGATTTACGTTATCCTGACACTGCATTTACAGAAATTTAATACCATCAA
GAACCAATTACTTCTATACAATGGTAACCAAATGAAGAATCTGTTTTATCAGTTACATCT
GCTGATAACAGACTAACTATTTGGGACTTTTCAGTTGAAAATGATGAAAACGTTGAAGAT
TACGGAGAAGAAATTCCTGATTAACTTATGTTTGTTCATTAAGGTTAATAAGACATGAAA
GAATTAAGATATCATCCTAAATATTATGAAATGATAGTAAGCACAGCTGCAGATGGTTTC
CACATATTCAAACCTGCATTAAACGACGAAGAAGAAAATGAAAAAGAAAAGGAAGATTTA
GAAAATGAAGATTTAAGCAAAATTCCTAAGATAAAAGAATCTGATTTAAATGCTTATTTA
GCTAAAATGAGCTTAAATTGA


>TTHERM_00467910(protein)
MSDNKKISQKRKLETAEDVSLNIKEQNQKKNPNKKKGDQAVVDEFEKNENFEEEEGSELE
FEDCEDDIDDEYVDEKTYKKIMQGNFQEDEEEWEDDGDDDDDENEEIGNEEEKQDINAKK
RNKKNKNQKVEFIDVQQKPFMGTEKNLEEDEILDFDNKAYEMLHRANTEWPCLSCDFVTG
EPHNINNPGFQEMKKYPYDVYVVAGTQSKQQNFIYLMRWSKLHKTKYDDDSDYQDDDEDD
INNDDEPELALQSIQIKDPVNRIRAMQNSPLVAYWTENGDVTIADLSSRYDILNQWDPKI
LASKPKNNPKDKVFTKTFHNQVEGFALDWSPIKPGRLASGSCDGKIFIYNAKNFAFNDWE
RDQHPYVYHEGSVEDLQFSPVEEYSLASCSTDGTIRVVDLRVGNKKQAQLLVKAHECDVN
VISWNHKNPFLIASGADDGCFKVWDLRYPDTAFTEIQYHQEPITSIQWQPNEESVLSVTS
ADNRLTIWDFSVENDENVEDYGEEIPDQLMFVHQGQQDMKELRYHPKYYEMIVSTAADGF
HIFKPALNDEEENEKEKEDLENEDLSKIPKIKESDLNAYLAKMSLN


>TTHERM_00467910(gene)
ATGAGTGACAATAAAAAGATAAGTTAAAAGAGAAAGCTTGAAACTGCTGAAGATGTTTCA
CTTAATATTAAAGAACAAAACTAGAAAAAAAATCCTAATAAGAAGAAAGGGGATTAAGCA
GTAGTTGACGAATTCGAAAAAAATGAAAATTTTGAAGAGGAAGAAGGATCTGAATTAGAA
TTTGAAGATTGTGAAGATGATATAGGTAATTTATACTTTTTTACAGCTTTTTACTAATTC
AGTTTTAAAAAATATGATTTTAATTATGTAGAGTTTATTTATTTATTATGATAAAAATAT
AATTTTGATAAAAATATATTCAAATTACAATAAAACAAATGATTATATTTTAATTATATA
GATGATGAATATGTTGATGAAAAGACATACAAAAAGATTATGTAAGGAAATTTCTAAGAA
GATGAAGAGGAATGGGAAGACGATGGAGATGATGACGATGATGAAAATGAAGAAATTGGT
AATGAAGAAGAAAAATAAGACATAAATGCAAAGAAGAGAAATAAAAAAAATAAAAACTAA
AAAGTTGAATTTATTGATGTTTAATAAAAGCCTTTCATGGGTACTGAAAAGAATTTAGAA
GAAGATGAAATTCTAGATTTCGATAATAAGGCATACGAAATGCTTCATAGAGCTAACACT
GAATGGTAATTTAAATTAACTACTTTTTACATCTTAAATATGAAGCATTTACATATATAA
ACAATCAAACCTCTTGAAAAATTTTTAAGTTTTTAGTTAGTTAAACACACAATTGATAAA
ATAAGTATTTAAGGTTAGTAAAATTCTACATGAAACTATCTATGTAGTTAGTTTTTTAGC
CAAAAATTACAATTGATCTAAAAATACAATAAACAAACAATGCACCTAAACAAAGATATT
AAATTGTTTTAAATATATTTAACAGGCCTTGCTTGTCATGTGATTTTGTAACTGGAGAAC
CTCATAATATTAATAACCCTGGCTTCTAAGAAATGAAAAAGTATCCTTATGATGTTTATG
TAGTAGCAGGTACCTAAAGCAAGTAATAAAATTTCATATACTTAATGAGATGGTCCAAAT
TACATAAGACAAAATATGACGATGATTCTGATTACTAAGATGATGATGAAGATGATATCA
ATAACGACGATGAACCTGAGCTTGCTTTACAAAGTATTTAAATTAAAGACCCTGTTAATC
GTATTAGAGCTATGTAAAACTCACCACTTGTTGCATATTGGACTGAAAATGGAGATGTCA
CTATTGCTGATTTGTCATCTCGTTATGATATACTTAACTAATGGGATCCAAAAATTTTAG
CTTCAAAACCCAAAAACAATCCTAAAGACAAAGTTTTTACCAAAACTTTCCATAATTAAG
TTGAAGGTTTTGCTCTTGATTGGAGTCCTATTAAGCCTGGCAGATTGGCTTCAGGTAGCT
GTGATGGCAAAATATTTATTTATAATGCTAAGAATTTTGCCTTTAACGATTGGGAGAGAG
ATCAACACCCTTATGTTTACCACGAAGGATCTGTCGAAGATCTTTAGTTCTCTCCTGTTG
AAGAATACAGTCTTGCTTCATGTAAAAATAATTTATATTTAGAAAATTAAAAGTTATTAA
ATTTTAACTTAAAATCAAGGTTCAACTGATGGAACAATTAGAGTAGTTGATTTAAGAGTA
GGTAATAAAAAATAAGCTCAATTACTTGTTAAAGCCCACGAATGTGATGTAAATGTTATT
TCTTGGAACCACAAGAATCCTTTCCTCATAGCATCAGGAGCAGATGATGGTTGCTTTAAA
GTTTGGGATTTACGTTATCCTGACACTGCATTTACAGAAATTTAATACCATCAAGAACCA
ATTACTTCTATACAATGGTAACCAAATGAAGAATCTGTTTTATCAGTTACATCTGCTGAT
AACAGACTAACTATTTGGGACTTTTCAGTTGAAAATGATGAAAACGTTGAAGATTACGGA
GAAGAAATTCCTGATTAACTTATGTTTGTTCATTAAGGTAATATATATTTTGAAATTTAA
AATATCATTTTACTAAATCAAAATTCAAAAATTTAGGTTAATAAGACATGAAAGAATTAA
GATATCATCCTAAATATTATGAAATGATAGTAAGCACAGCTGCAGATGGTTTCCACATAT
TCAAACCTGCATTAAACGACGAAGAAGAAAATGAAAAAGAAAAGGAAGATTTAGAAAATG
AAGATTTAAGCAAAATTCCTAAGATAAAAGAATCTGATTTAAATGCTTATTTAGCTAAAA
TGAGCTTAAATTGA