Identifiers and Description

Gene Model Identifier

TTHERM_00622800

Standard Name

NUP93 (Nucleoporin Nup93p)

Aliases

PreTt07367 | 87.m00147 | 3814.m00853 | Nup93

Description

Nucleoporin common to both MAC and MIC NPCs

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00622800

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11953.19.997093137033517e-262hypothetical protein (962 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:28386019: Iwamoto M, Osakada H, Mori C, Fukuda Y, Nagao K, Obuse C, Hiraoka Y, Haraguchi T (2017) Compositionally distinct nuclear pore complexes of functionally distinct dimorphic nuclei in the ciliate Tetrahymena. Journal of cell science 130(10):1822-1834
  2. Ref:25788697: Iwamoto M, Koujin T, Osakada H, Mori C, Kojidani T, Matsuda A, Asakawa H, Hiraoka Y, Haraguchi T (2015) Biased assembly of the nuclear pore complex is required for somatic and germline nuclear differentiation in Tetrahymena. Journal of cell science 128(9):1812-23
  3. Ref:19375312: Iwamoto M, Mori C, Kojidani T, Bunai F, Hori T, Fukagawa T, Hiraoka Y, Haraguchi T (2009) Two distinct repeat sequences of Nup98 nucleoporins characterize dual nuclei in the binucleated ciliate tetrahymena. Current biology : CB 19(10):843-7

Sequences

>TTHERM_00622800(coding)
ATGAGTTTTACTGTTGCTCGCGATGATAATAGGGACAAGCGTGGTTAAAATCAAACTGAA
GTTATGGAATAAAGACTTAAAAAATTATATCAGGATATTAGCATCCTTTAATCCAGAACA
GGAATCAAAAAGTAGCAAGTGAGCTAAAAAAATCTTGATTAGTTAATGTCTCTTTTAAAC
AAAAAGATATAGCAATATAGTTTTCCAGACACAATTATTGGATAAAACCACTACAAATTA
GTCTAAAAAGGCATGGATGCTCCTTCCCTTGAGCGTAAATTGCAGGAATAGAGATTTTTA
GCAGAAAAAGAATTGAGTAGTAAATCTAATTAAGAAAAGAGCCTATTTTGGATGGATATT
GTATTCTCAAAAGAAGGAATTGATACTTATTTAGAAAACAATCAAAACTATTTAATGTTT
AACTCTGTCGATACTATGAGAAGCCGTAACTCGAAAGGGGAAACTTTTGCTACTCGTTTG
CTTGCAAAAAAATCCTAACTTCGTGGTATTCTTGGTGATACTTATAGAGGAAATGTTGCA
GCATTAGCATCTGCACCAGGATTTAAGTACGATTAATTTCATCGCTTTGAGTAAGAGTCA
TCTTAAAATATTGATGATTATATTAAAGCTATGAGTTAATTTTAGTAAGGAAATTACACA
AAGTACTGTGATTATCTTGCAAAGAAATCAATTGATTATAAAGAGGTTTGGTAACTTTTA
GAGAAGATGGTTCCTACAGATGGATCAAACATATTTAAAATAAGTAAGAGATTGCAACGT
TTAAGAAAATCTGGGTAGTAGAATTAAAATTAATTACAATGCTTGTAAAATAATTTCAAT
TTGTAAAATGCTTATCATAATGGTATTTAGTATCTCCAATAAATTTACCGTAAAAATGCT
AAATAAAAAAAGCAAAACTTTTAGAGAATCTACGATGTTTATAATGTTGATTAGATCCGT
GGTTTTGATGATGATAATATCCCTATATGGTAAGAAATTTATCAGTTATTTAGAGCTGGT
GATTACGATGGTATTTTTAATCGCTGCCAATATTTCTCCAATGTAAGTGAAATTTAAGAG
TTTTAAAAAGATCTTGACATTTGGCTCAAAAGTGGATAACGTAAAAATAACTAACTAAGC
TAAAAAATACGTCCTAATTGGGATGCTTTCCGTTATCAAATATACCTCATTATGATAAAA
GACCCTTCTTGTGTCGACGACGTCTTTATTGAAGATTTAGATGACTGCCTATGGATGAAC
TTAAAATGCAGTGAAGTTTATGTTCCTCCTAACTAACAAGATCCTATTAATCCTATGAAC
ATCGAAGACGATATTGAAGATTAATACGAAGTACTTAATGGAAATAATCTCAGCACTAAC
GTATTAAATTAATCTGTTTAAGAGGATGAAAAAGATAATTTTTATGATACTGTTTTAAAA
GCAAGCTTAGACATTTCTCAAGATGAAATTCTTCCAGGAGAAGATGTTTACTCATGGATA
GACTGGAATTAGTTGCAAGACTTAAGGAAAATGCTTTATGAATCTTTCAAGGAATCTCCA
GATGTCTTTAATCCTTCTCGTGTTCTTATGATCTAATTGCTAACTCTAGATTTCATTGGT
TTTGTACAAACACTTTTACAATTAGAAAAAAGTGCTATCTCTCAACATGAATTCACTCAT
TTCTTAATTTTAATCTTAAAAACTGGTTTGGTGCGTGCTTCTGTTGAATGTTCTGTCAAA
TTTGCTGAATCTGGAAATTCATCCTATGGAGAAAGTAAGGACATTCTTGTAAGAAGATGC
AAGGAATTCGAAGAAAGCGCAGAGAAAAAAATAATTCTTTATGCTAAAGATAGATTTGAT
AATTATCCAGATACTTGTTTTTCTTATATTGAATCTCTTCCTATAAAAGTTGAGGATTAA
TTGAAAAAGTATGCAAATATCTATGTTGGATCTAAATAAAATTTTATCCATCTGTTTAAG
CCAAACCTTAATTTCTCTTAATAGCTTGATTCTAATTCAATGACTTCGAATAATAGTCAA
TCATAAAACAGAGGAAAAGTTTTTGACTAAATTTGTAAAATAAATAATCGTCTAAAAAAG
ATAACTTACACAACTAAGGCATAACTAAGAACAGGATAGAATGTTCAAAGCGAAAATTTA
CTTACACTTTTAGCCAAAATAGTAGCATAAACCTACATTCAAACATAGAATAAGGTAGAA
GTAGCTCTTGAAATTCTTGATAACGTAGGTGCCTTTGAAGATATTGGTAGAATATTGAAG
GAATAATTCCGCTTATGCACTTCTCTTTCATAGAATCATGCTCTCAAAAGTAAACTAAAA
GACCATTCTGATAACTAAAAAATTCTAGAAACACTAGAAAAATATACTGAAAAATATTTC
GGATTAGGAAAGAAGTTCAAAAAGGTGTATCGCGAAGAAAAGAAATAATATATCGACTGC
CATATCATTCATTTCTATAAGCTTTTCTATAAGATTAAAGTTTCATACTAGAATCAAGAA
TACAATATTTCATCTGTCTTGCTTGAAATGCAAGAAGCAGAATACATCTCATCAAATAAA
AAGAAATCAGCAGCATCTGAATTCTTTGCTAATTTCTAACCTGATGAGAAATAATCCTAT
TTCGATTTCTTATATTTAGTGTATCTCTGTACTAAAAAGTTTATGGATTAACACAAAAAT
CCTGGCTTGTACAATCAAGCTCATAAACTCTAGAAACCTGAAGATTTTGAAAAGGCAAAA
CCAATATTTAGCAGCATAATTAAATATTGCAATGATTTTGTTGAAAAAAATATTAGGAGC
GTGGATTCCTAATTTGAAAAGACCTTATTAGAAGCTAAACACAATGCCTAAGTTACAGAT
TAAGTTTGA


>TTHERM_00622800(protein)
MSFTVARDDNRDKRGQNQTEVMEQRLKKLYQDISILQSRTGIKKQQVSQKNLDQLMSLLN
KKIQQYSFPDTIIGQNHYKLVQKGMDAPSLERKLQEQRFLAEKELSSKSNQEKSLFWMDI
VFSKEGIDTYLENNQNYLMFNSVDTMRSRNSKGETFATRLLAKKSQLRGILGDTYRGNVA
ALASAPGFKYDQFHRFEQESSQNIDDYIKAMSQFQQGNYTKYCDYLAKKSIDYKEVWQLL
EKMVPTDGSNIFKISKRLQRLRKSGQQNQNQLQCLQNNFNLQNAYHNGIQYLQQIYRKNA
KQKKQNFQRIYDVYNVDQIRGFDDDNIPIWQEIYQLFRAGDYDGIFNRCQYFSNVSEIQE
FQKDLDIWLKSGQRKNNQLSQKIRPNWDAFRYQIYLIMIKDPSCVDDVFIEDLDDCLWMN
LKCSEVYVPPNQQDPINPMNIEDDIEDQYEVLNGNNLSTNVLNQSVQEDEKDNFYDTVLK
ASLDISQDEILPGEDVYSWIDWNQLQDLRKMLYESFKESPDVFNPSRVLMIQLLTLDFIG
FVQTLLQLEKSAISQHEFTHFLILILKTGLVRASVECSVKFAESGNSSYGESKDILVRRC
KEFEESAEKKIILYAKDRFDNYPDTCFSYIESLPIKVEDQLKKYANIYVGSKQNFIHLFK
PNLNFSQQLDSNSMTSNNSQSQNRGKVFDQICKINNRLKKITYTTKAQLRTGQNVQSENL
LTLLAKIVAQTYIQTQNKVEVALEILDNVGAFEDIGRILKEQFRLCTSLSQNHALKSKLK
DHSDNQKILETLEKYTEKYFGLGKKFKKVYREEKKQYIDCHIIHFYKLFYKIKVSYQNQE
YNISSVLLEMQEAEYISSNKKKSAASEFFANFQPDEKQSYFDFLYLVYLCTKKFMDQHKN
PGLYNQAHKLQKPEDFEKAKPIFSSIIKYCNDFVEKNIRSVDSQFEKTLLEAKHNAQVTD
QV


>TTHERM_00622800(gene)
ATGAGTTTTACTGTTGCTCGCGATGATAATAGGGACAAGCGTGGTTAAAATCAAACTGAA
GTTATGGAATAAAGACTTAAAAAATTATATCAGGATATTAGCATCCTTTAATCCAGAACA
GGAATCAAAAAGTAGCAAGTGAGCTAAAAAAATCTTGATTAGTTAATGTCTCTTTTAAAC
AAAAAGATATAGCAATATAGTTTTCCAGACACAATTATTGGATAAAACCACTACAAATTA
GTCTAAAAAGGCATGGATGCTCCTTCCCTTGAGCGTAAATTGCAGGAATAGAGATTTTTA
GCAGAAAAAGAATTGAGTAGTAAATCTAATTAAGAAAAGAGCCTATTTTGGATGGATATT
GTATTCTCAAAAGAAGGAATTGATACTTATTTAGAAAACAATCAAAACTATTTAATGTTT
AACTCTGTCGATACTATGAGAAGCCGTAACTCGAAAGGGGAAACTTTTGCTACTCGTTTG
CTTGCAAAAAAATCCTAACTTCGTGGTATTCTTGGTGATACTTATAGAGGAAATGTTGCA
GCATTAGCATCTGCACCAGGATTTAAGTACGATTAATTTCATCGCTTTGAGTAAGAGTCA
TCTTAAAATATTGATGATTATATTAAAGCTATGAGTTAATTTTAGTAAGGAAATTACACA
AAGTACTGTGATTATCTTGCAAAGAAATCAATTGATTATAAAGAGGTTTGGTAACTTTTA
GAGAAGATGGTTCCTACAGATGGATCAAACATATTTAAAATAAGTAAGAGATTGCAACGT
TTAAGAAAATCTGGGTAGTAGAATTAAAATTAATTACAATGCTTGTAAAATAATTTCAAT
TTGTAAAATGCTTATCATAATGGTATTTAGTATCTCCAATAAATTTACCGTAAAAATGCT
AAATAAAAAAAGCAAAACTTTTAGAGAATCTACGATGTTTATAATGTTGATTAGATCCGT
GGTTTTGATGATGATAATATCCCTATATGGTAAGAAATTTATCAGTTATTTAGAGCTGGT
GATTACGATGGTATTTTTAATCGCTGCCAATATTTCTCCAATGTAAGTGAAATTTAAGAG
TTTTAAAAAGATCTTGACATTTGGCTCAAAAGTGGATAACGTAAAAATAACTAACTAAGC
TAAAAAATACGTCCTAATTGGGATGCTTTCCGTTATCAAATATACCTCATTATGATAAAA
GACCCTTCTTGTGTCGACGACGTCTTTATTGAAGATTTAGATGACTGCCTATGGATGAAC
TTAAAATGCAGTGAAGTTTATGTTCCTCCTAACTAACAAGATCCTATTAATCCTATGAAC
ATCGAAGACGATATTGAAGATTAATACGAAGTACTTAATGGAAATAATCTCAGCACTAAC
GTATTAAATTAATCTGTTTAAGAGGATGAAAAAGATAATTTTTATGATACTGTTTTAAAA
GCAAGCTTAGACATTTCTCAAGATGAAATTCTTCCAGGAGAAGATGTTTACTCATGGATA
GACTGGAATTAGTTGCAAGACTTAAGGAAAATGCTTTATGAATCTTTCAAGGAATCTCCA
GATGTCTTTAATCCTTCTCGTGTTCTTATGATCTAATTGCTAACTCTAGATTTCATTGGT
TTTGTACAAACACTTTTACAATTAGAAAAAAGTGCTATCTCTCAACATGAATTCACTCAT
TTCTTAATTTTAATCTTAAAAACTGGTTTGGTGCGTGCTTCTGTTGAATGTTCTGTCAAA
TTTGCTGAATCTGGAAATTCATCCTATGGAGAAAGTAAGGACATTCTTGTAAGAAGATGC
AAGGAATTCGAAGAAAGCGCAGAGAAAAAAATAATTCTTTATGCTAAAGATAGATTTGAT
AATTATCCAGATACTTGTTTTTCTTATATTGAATCTCTTCCTATAAAAGTTGAGGATTAA
TTGAAAAAGTATGCAAATATCTATGTTGGATCTAAATAAAATTTTATCCATCTGTTTAAG
CCAAACCTTAATTTCTCTTAATAGCTTGATTCTAATTCAATGACTTCGAATAATAGTCAA
TCATAAAACAGAGGAAAAGTTTTTGACTAAATTTGTAAAATAAATAATCGTCTAAAAAAG
ATAACTTACACAACTAAGGCATAACTAAGAACAGGATAGAATGTTCAAAGCGAAAATTTA
CTTACACTTTTAGCCAAAATAGTAGCATAAACCTACATTCAAACATAGAATAAGGTAGAA
GTAGCTCTTGAAATTCTTGATAACGTAGGTGCCTTTGAAGATATTGGTAGAATATTGAAG
GAATAATTCCGCTTATGCACTTCTCTTTCATAGAATCATGCTCTCAAAAGTAAACTAAAA
GACCATTCTGATAACTAAAAAATTCTAGAAACACTAGAAAAATATACTGAAAAATATTTC
GGATTAGGAAAGAAGTTCAAAAAGGTGTATCGCGAAGAAAAGAAATAATATATCGACTGC
CATATCATTCATTTCTATAAGCTTTTCTATAAGATTAAAGTTTCATACTAGAATCAAGAA
TACAATATTTCATCTGTCTTGCTTGAAATGCAAGAAGCAGAATACATCTCATCAAATAAA
AAGAAATCAGCAGCATCTGAATTCTTTGCTAATTTCTAACCTGATGAGAAATAATCCTAT
TTCGATTTCTTATATTTAGTGTATCTCTGTACTAAAAAGTTTATGGATTAACACAAAAAT
CCTGGCTTGTACAATCAAGCTCATAAACTCTAGAAACCTGAAGATTTTGAAAAGGCAAAA
CCAATATTTAGCAGCATAATTAAATATTGCAATGATTTTGTTGAAAAAAATATTAGGAGC
GTGGATTCCTAATTTGAAAAGACCTTATTAGAAGCTAAACACAATGCCTAAGTTACAGAT
TAAGTTTGA