Identifiers and Description

Gene Model Identifier

TTHERM_00455610

Standard Name

NUP88 (NUcleoPorin 88)

Aliases

PreTt20290 | 53.m00192 | 3712.m00053

Description

Nucleoporin protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.7%

TetraMine Data

TTHERM_00455610

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_363680
Tetrahymena borealisEI9_13753.19.997093137033517e-262hypothetical protein (937 aa)
DictyBaseDDB_G02790390.000019995566179747357DDB_G0279039 on chromosome: 3
position 1541078 to 1544303

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:28386019: Iwamoto M, Osakada H, Mori C, Fukuda Y, Nagao K, Obuse C, Hiraoka Y, Haraguchi T (2017) Compositionally distinct nuclear pore complexes of functionally distinct dimorphic nuclei in the ciliate Tetrahymena. Journal of cell science 130(10):1822-1834

Sequences

>TTHERM_00455610(coding)
ATGGAGAATAACCTTTTAGAATCAAGACTAAATAAAATCTTGTCAGATAAAAAGTTTAGC
AAATTGAATAAAAGCATAGAGAAGCATCTCAATAAGGAAACAGGCATTTTTATTAAGGAC
TACTTTTTAGTTCTTGAATATGAATCACTTGATGAAAAGGTAATTCAGAGTAAAAAGAAG
GAGCTTTTAGAAAATTCAATGCACGATCATATAGAAAAAGATGACGATTCTGTTTAATAC
TTTGCACTATACTTATGGATTTTTAATTTGACTGCAGGCCAATTCTTAGAAAATAACGAA
AATAAATTAGCTACTAGAATACCTGTAAATTTACAAAGTTACAACATGTTCAATGCACAA
GATTAATAAATATAGTCTGCCAAAAACACAATCGAAAGCTTTGGTAACGTCTTTTGCATG
TCTAAGAAAATCGGAGAGTAATCTCTCTAAATAATAAATAGTAATATAGATGAATACTAA
ATAGCAATTTATTCTGAAAAATAAATTTTTGTTGGCCATATTGAAAACATTATAAATTCC
TATTTTATTAAGCAAAGCAAAGATGATCAAAATGCCTTTACAATGTACCGTGTATAATTA
TTTATATAAAAATACTCTCCAAGCATTTTAAGCATTAAATTCCACAAATTATCTCCTCAT
CATTTGGCTGTTCTTTTAGATGATTAGTACTTTTGCGTTTATAATCTGCAATCTAGTCTT
TCTTACTAGGAGGTGTAATTTAATCTTTAATAACTTCCACGCTTTGGTAGAAACGAAGAG
TATAATTATTAAGAAAAAGGATAAGTTTAGTTTGTTGATTTCGAATTTGGAGGCAACAGC
TTTTTCACTAGCTATTCGAAAACCAATTTCTAAATTCCTTCTGATTTCGATTTTCTGTCA
GTATATTTTCTTACTGAAGATGGTTAAATTTACTACCAATCTCCATTTTTAGTAAAAGAT
ATGAGAATTAACAGATAATTAATTGAAGAACTTAAGGATTATCTTGTTCAAGAATTAAAA
TTGGTGGAACAGCATGAATAAATATAAGAAAAATTATAGGTGTTAAAATCTTATTTAGAC
TTAGTAGAATAAATTGACAGCAGAGATTTGATAAGTGAATGCGAATAACCTACCAAATTA
TCTAAAATAGTTACTCAAACAGATAAGTCCAGTTCATTTGAAGTTCCTATTTTTAATAGC
ATCAGCATGCAAGACTTGCTGAATGATGATTTCTAAATACAATTAAGATATGTTCCTACA
GAATAAAATAACGAAGATGATTAAGAAAATTTAGAAAATAACAGTAACTTACAGTCTCAG
TTTAAATCAAGTGGCTTTGGAACAAAATCTAACATCTAAGTTTTTTCAAAATCGTTAATG
GACAGATTTACTAGAGATAATAAGAATCAAATTATGTATAGGAAATATAGTAAATTCCAC
AAAGTGGAAACAAAGGGTTAACTCCATGTCTTTATTTTAACAAAGCAAATCGGTAATAAA
ACTTACTCTACTGTATCTTCACGTTTTAGTCCTCTTCCAGTCATGCCTACTCATATTGTT
CAAGACTTTTACTAGTTTTGTCTTTTATCTGGTGAAAAAGCACATCTTGAATGCCCATTA
AGCTCTTTAATCAACTATACAGGAAATTAATCTAAAAAGAATATCTATGAATATAAATAA
AATTAATGTGCTAGACTCTGTTCTAAGGCAATTGAAACATCAACACTTGACAGTGTTTGC
TTCTAACTTATGAATAGAATATATTGTATTAACTTTAAGTGGATTTAGAATTTGATTTTA
ACAAACTTATCAGACCCTAAAGTATTTAATGATGAAGAATTGTCTAGAAGTGAAATTAGA
GTCTTAGTTGATTCTCAGCAAATCGATAGCTAGGATAAATTAGATGCATGTAAATTAACA
GATTTATCTTTTTATTGCTTATCTGAAAAAGACAGAATGCTTCTAGCAGTTATTCCTTCC
CACCACTCACAATAGTAATAGCCTTTTAGGTTAAAATGCTTAACTTTAGACTTCTTGTCA
AACTATATTTAAATTTAAAAGAGTGCTAAGCTTATATCTGAGACTTTACACAAGATGATT
AAAGAATAAGTAGAGCCTGAAAAAGCAAAAGAAAATAACCAATCAGGATAAAAACTAGCT
TAAAATGATGTGAAGCTTCAGGAAATTGCTGATTAAGATAATAAAGTAGATCTTGATAAC
TTTTAAAAGTAAGTAACAGCTTACATAAGCAAGCATGAAGAAGTTTTATAATAGAATATT
TAGTTAATACAAATTAAATATCAAGAGGTATTAAAGAAAAAAGAAGAGTTGAAAAATACA
AAGGAAAAAACAGAAAGCCAATTTTATGAAATCATAGAAAACAAATAAAAGAAGTTGTTA
GAAAGCAAAAAAAGAATTGAAGAAAAAAATAAGTCAATCAATTAAAAAATTTAAGAAATT
GCTTAAAAATTAAAAGACCCTAAAGCTTCAAATGAATTAGACAATGTTAAAGAAGCAAAT
ATCACATTTAATGAAAAATATAATGAGTAAATTAAGACATACTATAATAAACTTAAAGAA
ATCGAAGAATAATACTAAAAGTACTTCAAAACTAGAAGTGAGTTCTTCAATTCATTAGGT
GTTCAAAGCAATACAAACCTACAAATTGATGAAAACACTTTATAAAAAATTAATGAAACA
AGAAATAAGCTAAAATACCACATGAAAATCCTTGATAATTAGATCATTTAAACCAATCCT
CAAGATAATTGA


>TTHERM_00455610(protein)
MENNLLESRLNKILSDKKFSKLNKSIEKHLNKETGIFIKDYFLVLEYESLDEKVIQSKKK
ELLENSMHDHIEKDDDSVQYFALYLWIFNLTAGQFLENNENKLATRIPVNLQSYNMFNAQ
DQQIQSAKNTIESFGNVFCMSKKIGEQSLQIINSNIDEYQIAIYSEKQIFVGHIENIINS
YFIKQSKDDQNAFTMYRVQLFIQKYSPSILSIKFHKLSPHHLAVLLDDQYFCVYNLQSSL
SYQEVQFNLQQLPRFGRNEEYNYQEKGQVQFVDFEFGGNSFFTSYSKTNFQIPSDFDFLS
VYFLTEDGQIYYQSPFLVKDMRINRQLIEELKDYLVQELKLVEQHEQIQEKLQVLKSYLD
LVEQIDSRDLISECEQPTKLSKIVTQTDKSSSFEVPIFNSISMQDLLNDDFQIQLRYVPT
EQNNEDDQENLENNSNLQSQFKSSGFGTKSNIQVFSKSLMDRFTRDNKNQIMYRKYSKFH
KVETKGQLHVFILTKQIGNKTYSTVSSRFSPLPVMPTHIVQDFYQFCLLSGEKAHLECPL
SSLINYTGNQSKKNIYEYKQNQCARLCSKAIETSTLDSVCFQLMNRIYCINFKWIQNLIL
TNLSDPKVFNDEELSRSEIRVLVDSQQIDSQDKLDACKLTDLSFYCLSEKDRMLLAVIPS
HHSQQQQPFRLKCLTLDFLSNYIQIQKSAKLISETLHKMIKEQVEPEKAKENNQSGQKLA
QNDVKLQEIADQDNKVDLDNFQKQVTAYISKHEEVLQQNIQLIQIKYQEVLKKKEELKNT
KEKTESQFYEIIENKQKKLLESKKRIEEKNKSINQKIQEIAQKLKDPKASNELDNVKEAN
ITFNEKYNEQIKTYYNKLKEIEEQYQKYFKTRSEFFNSLGVQSNTNLQIDENTLQKINET
RNKLKYHMKILDNQIIQTNPQDN


>TTHERM_00455610(gene)
ATGGAGAATAACCTTTTAGAATCAAGACTAAATAAAATCTTGTCAGATAAAAAGTTTAGC
AAATTGAATAAAAGCATAGAGAAGCATCTCAATAAGGAAACAGGCATTTTTATTAAGGAC
TACTTTTTAGTTCTTGAATATGAATCACTTGATGAAAAGGTAATTCAGAGTAAAAAGAAG
GAGCTTTTAGAAAATTCAATGCACGATCATATAGAAAAAGATGACGATTCTGTTTAATAC
TTTGCACTATACTTATGGATTTTTAATTTGACTGCAGGCCAATTCTTAGAAAATAACGAA
AATAAATTAGCTACTAGAATACCTGTAAATTTACAAAGTTACAACATGTTCAATGCACAA
GATTAATAAATATAGTCTGCCAAAAACACAATCGAAAGCTTTGGTAACGTCTTTTGCATG
TCTAAGAAAATCGGAGAGTAATCTCTCTAAATAATAAATAGTAATATAGATGAATACTAA
ATAGCAATTTATTCTGAAAAATAAATTTTTGTTGGCCATATTGAAAACATTATAAATTCC
TATTTTATTAAGCAAAGCAAAGATGATCAAAATGCCTTTACAATGTACCGTGTATAATTA
TTTATATAAAAATACTCTCCAAGCATTTTAAGCATTAAATTCCACAAATTATCTCCTCAT
CATTTGGCTGTTCTTTTAGATGATTAGTACTTTTGCGTTTATAATCTGCAATCTAGTCTT
TCTTACTAGGAGGTGTAATTTAATCTTTAATAACTTCCACGCTTTGGTAGAAACGAAGAG
TATAATTATTAAGAAAAAGGATAAGTTTAGTTTGTTGATTTCGAATTTGGAGGCAACAGC
TTTTTCACTAGCTATTCGAAAACCAATTTCTAAATTCCTTCTGATTTCGATTTTCTGTCA
GTATATTTTCTTACTGAAGATGGTTAAATTTACTACCAATCTCCATTTTTAGTAAAAGAT
ATGAGAATTAACAGATAATTAATTGAAGAACTTAAGGATTATCTTGTTCAAGAATTAAAA
TTGGTGGAACAGCATGAATAAATATAAGAAAAATTATAGGTGTAAGCAATTAAACTACTT
TCATTCTATAATATATAAGTTTTAAATATGTTTATTAGAGTTTTGAGTTTTAAAAAATAA
AAATATTTTATTTAATTAAAAGGTTAAAATCTTATTTAGACTTAGTAGAATAAATTGACA
GCAGAGATTTGATAAGTGAATGCGAATAACCTACCAAATTATCTAAAATAGTTACTCAAA
CAGATAAGTCCAGTTCATTTGAAGTTCCTATTTTTAATAGCATCAGCATGCAAGACTTGC
TGAATGATGATTTCTAAATACAATTAAGATATGTTCCTACAGAATAAAATAACGAAGATG
ATTAAGAAAATTTAGAAAATAACAGTAACTTACAGTCTCAGTTTAAATCAAGTGGCTTTG
GAACAAAATCTAACATCTAAGTTTTTTCAAAATCGTTAATGGACAGATTTACTAGAGATA
ATAAGAATCAAATTATGTATAGGAAATATAGTAAATTCCACAAAGTGGAAACAAAGGGTT
AACTCCATGTCTTTATTTTAACAAAGCAAATCGGTAATAAAACTTACTCTACTGTATCTT
CACGTTTTAGTCCTCTTCCAGTCATGCCTACTCATATTGTTCAAGACTTTTACTAGTTTT
GTCTTTTATCTGGTGAAAAAGCACATCTTGAATGCCCATTAAGCTCTTTAATCAACTATA
CAGGAAATTAATCTAAAAAGAATATCTATGAATATAAATAAAATTAATGTGCTAGACTCT
GTTCTAAGGCAATTGAAACATCAACACTTGACAGTGTTTGCTTCTAACTTATGAATAGAA
TATATTGTATTAACTTTAAGTGGATTTAGAATTTGATTTTAACAAACTTATCAGACCCTA
AAGTATTTAATGATGAAGAATTGTCTAGAAGTGAAATTAGAGTCTTAGTTGATTCTCAGC
AAATCGATAGCTAGGATAAATTAGATGCATGTAAATTAACAGATTTATCTTTTTATTGCT
TATCTGAAAAAGACAGAATGCTTCTAGCAGTTATTCCTTCCCACCACTCACAATAGTAAT
AGCCTTTTAGGTTAAAATGCTTAACTTTAGACTTCTTGTCAAACTATATTTAAATTTAAA
AGAGTGCTAAGCTTATATCTGAGACTTTACACAAGATGATTAAAGAATAAGTAGAGCCTG
AAAAAGCAAAAGAAAATAACCAATCAGGATAAAAACTAGCTTAAAATGATGTGAAGCTTC
AGGAAATTGCTGATTAAGATAATAAAGTAGATCTTGATAACTTTTAAAAGTAAGTAACAG
CTTACATAAGCAAGCATGAAGAAGTTTTATAATAGAATATTTAGTTAATACAAATTAAAT
ATCAAGAGGTATTAAAGAAAAAAGAAGAGTTGAAAAATACAAAGGAAAAAACAGAAAGCC
AATTTTATGAAATCATAGAAAACAAATAAAAGAAGTTGTTAGAAAGCAAAAAAAGAATTG
AAGAAAAAAATAAGTCAATCAATTAAAAAATTTAAGAAATTGCTTAAAAATTAAAAGACC
CTAAAGCTTCAAATGAATTAGACAATGTTAAAGAAGCAAATATCACATTTAATGAAAAAT
ATAATGAGTAAATTAAGACATACTATAATAAACTTAAAGAAATCGAAGAATAATACTAAA
AGTACTTCAAAACTAGAAGTGAGTTCTTCAATTCATTAGGTGTTCAAAGCAATACAAACC
TACAAATTGATGAAAACACTTTATAAAAAATTAATGAAACAAGAAATAAGCTAAAATACC
ACATGAAAATCCTTGATAATTAGATCATTTAAACCAATCCTCAAGATAATTGA