Identifiers and Description

Gene Model Identifier

TTHERM_01028760

Standard Name

NUP85 (NUclear Pore)

Aliases

PreTt10805 | 204.m00034

Description

Scaffold nuclear pore protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_01028760

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10483.10.00000000000003999587784428659hypothetical protein (171 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:28386019: Iwamoto M, Osakada H, Mori C, Fukuda Y, Nagao K, Obuse C, Hiraoka Y, Haraguchi T (2017) Compositionally distinct nuclear pore complexes of functionally distinct dimorphic nuclei in the ciliate Tetrahymena. Journal of cell science 130(10):1822-1834

Sequences

>TTHERM_01028760(coding)
ATGATACCTGAAAACAATAACTTATTTGTTAATAAAAATTCTATCTAAAATAATTAGAAT
CCTGTGCTATTTTGCTGGGGAGTAGATAATGAATTATTTGTTTATGACCAAAATAATAGT
TTCAATAGTACAAAAAGTAAAAAGGGATAGGCAGTTAATTTATATTTCTCAGATATTATT
CCACCATCATTTAGAGATATGGTCAAAGATTTCAGCGAAATATTCTAAAATTTCCACAAT
CAAAGATAAAAAATAGATGAGAATTTCATTAAAGTAAAATCAGAAGAAATAAAAATGATT
TCAACAAACTAACAAACCAAGTATGCAAGTGAAAAAGAATTTATGGAACAGTATCAAGAT
ATTTCTGTATAAGCATTAGATTAATACATAGACACATTTAAAAGATACTTATAAATAGGC
ATCTAAAATTAATGGACTTAGTAACACTTGAATTATACAATAATAAGCTTAATATACTAT
GACTTTATTAAGAATCTAAAGATAGAAAAGCAAAGATCAAAGCTCAAGAAAATAGATTTT
TCAAAATCAGAAATGATTGTTAGATTACTTAATTTATACCAAGACTCAACTAATCCAACA
ATAAATCAAGAAATCCTTACGTTTGATGTTTGGAGCTAAATTTATCATTTCTTAAAAAAT
CTGAATATAAGCCAAGTTATTTGCCTGTTAGAAGACTAAAAAGGATACGAAAAAAGGATA
ATACTCAACATAATTGATGCTTTAAAAATGAAGAAATATTTTTTTAAAGGCCAAGATGCT
AGACTTATCCCAAAGCAAGAATTTATTAGAAGACATGAAGAGTTTAAATAAAGAATATAA
GAAATAAGTAAAAATGTTAATCCTTAGAGTGAACTTTATTTCTTTTTGCAAGTGCTTAGT
GGCAACATTCAGTTTATACACACCTTCTGCTAATAAGATTGGATGACTTTTGTTATTTTT
TATATACTTTTTGCTAACCCTATATTCACAATAGACTAGCTCAAAACTTAAATTCATGAA
TGCTATTAGCATCAAATTGAAAAGAGCGGGGATCACGTTTAACAAATGTTTTTCTATTTG
ATTACTCAATTAGACTGCTATGCTAGTATTCAGAAAGCTTAGGGCATTCTTCATCCTTTC
TATTTTTTCCATTTGATAGATATCTTACAAGTTGCTGAATTCACTTTTGATGACTATACT
CCCACATACGATTAACTATAGAGAAATTTTAGGGAAGAAATTTAGTTTAAGTTTTTATAA
TATCTTTAAAATGATATTTTTGACTATCAATTAATGAGCATTTACATCAACAATTTTGTA
CAGAGAGTTGATATTATAGATAAGAAACTGAATCACAGCTAAATATTTGAAGATTTGTTG
GTCTCTAAAAGCAACACTGTGAGTAACTTTGCTTAAATAGTCTAAGATGTGTAAAAAGAA
AAAGATCCTATACTAAATGAAAGTGTTAAAAGCTAAATATCTGCTAAAGCTATGAGCTTA
TTGCAATAAAATTAATACGATAAAGCTCTTGAATTTTATATTTAATTAGCTGATTTCTAA
ATTGAAGAATGTCCTCCATAAAATGAAGATTTCTAAAAAGTATTAACAGGCTCTCAATTA
AAAAAAATTGAAGAGAATTATAAATATTTGAGAGAGCTTATTGTAAATTTATTATTTTAG
AGATGTGATGTTGATTTAAAGTCTATTGTAGATTGCTTGGAAAAAAAATCTTGTATTATC
AATAAGTATTACATTCATACTTAAGTTATAAGAAAGCACCTAAATTTTTTGTACTCTTAT
GAAAAACTTGCAGATGCTATTAGTAAGTTAAATAGGGATAATAACTTTTAAGATAAAAAC
TTATTAGGATCAATTGAGTAAGACATATACAACCTGATAAAATTGTAAAACTGTTTATCA
AAAGAGCTTGTCATAGGTCTTAGATTAATAGAAACAGTATTAAAAGCATCCCAGATAAAG
TTGTCATAATAAATTTATAATATTTTAGTGCTCAGAACTTAGTAATTAATGAGGGAAATC
AAAGAAAACATTATGGAATATGAGTTGTTAAATGATATCTAAAATATTCAAATTTATAAA
TAGCTAAATCAGGAAATGTAGCACTTTATTTCAATAGTTATGAACAGCTATACATTATGA


>TTHERM_01028760(protein)
MIPENNNLFVNKNSIQNNQNPVLFCWGVDNELFVYDQNNSFNSTKSKKGQAVNLYFSDII
PPSFRDMVKDFSEIFQNFHNQRQKIDENFIKVKSEEIKMISTNQQTKYASEKEFMEQYQD
ISVQALDQYIDTFKRYLQIGIQNQWTQQHLNYTIISLIYYDFIKNLKIEKQRSKLKKIDF
SKSEMIVRLLNLYQDSTNPTINQEILTFDVWSQIYHFLKNLNISQVICLLEDQKGYEKRI
ILNIIDALKMKKYFFKGQDARLIPKQEFIRRHEEFKQRIQEISKNVNPQSELYFFLQVLS
GNIQFIHTFCQQDWMTFVIFYILFANPIFTIDQLKTQIHECYQHQIEKSGDHVQQMFFYL
ITQLDCYASIQKAQGILHPFYFFHLIDILQVAEFTFDDYTPTYDQLQRNFREEIQFKFLQ
YLQNDIFDYQLMSIYINNFVQRVDIIDKKLNHSQIFEDLLVSKSNTVSNFAQIVQDVQKE
KDPILNESVKSQISAKAMSLLQQNQYDKALEFYIQLADFQIEECPPQNEDFQKVLTGSQL
KKIEENYKYLRELIVNLLFQRCDVDLKSIVDCLEKKSCIINKYYIHTQVIRKHLNFLYSY
EKLADAISKLNRDNNFQDKNLLGSIEQDIYNLIKLQNCLSKELVIGLRLIETVLKASQIK
LSQQIYNILVLRTQQLMREIKENIMEYELLNDIQNIQIYKQLNQEMQHFISIVMNSYTL


>TTHERM_01028760(gene)
ATGATACCTGAAAACAATAACTTATTTGTTAATAAAAATTCTATCTAAAATAATTAGAAT
CCTGTGCTATTTTGCTGGGGAGTAGATAATGAATTATTTGTTTATGACCAAAATAATAGT
TTCAATAGTACAAAAAGTAAAAAGGGATAGGCAGTTAATTTATATTTCTCAGATATTATT
CCACCATCATTTAGAGATGTATTTAGTTATTATCTTTTTAATAAACTTTAGTTTAAAATT
TGTTTTTTATTTGAAGCTTCTTTTTATTATTGTTTCATAAAGATTTAATATTACTTAACA
GATGGTCAAAGATTTCAGCGAAATATTCTAAAATTTCCACAATCAAAGATAAAAAATAGA
TGAGAATTTCATTAAAGTAAAATCAGAAGAAATAAAAATGATTTCAACAAACTAACAAAC
GTATTTAAAAATATCTTATTCTTGCTATAATCTTTTCTTGAATATAAATAAATAAATAAT
AGCAAGTATGCAAGTGAAAAAGAATTTATGGAACAGTATCAAGATATTTCTGTATAAGCA
TTAGATTAATACATAGACACATTTAAAAGATACTTATAAATAGGCATCTAAAATTAATGG
ACTTAGTAACACTTGAATTATACAATAGTAAATATATGTAATTGATTGATTTGCTTACTA
AGAATTCTTTTAATATAATAGATAAGCTTAATATACTATGACTTTATTAAGAATCTAAAG
ATAGAAAAGCAAAGATCAAAGCTCAAGAAAATAGATTTTTCAAAATCAGAAATGATTGTT
AGATTACTTAATTTATACCAAGACTCAACTAATCCAACAATAAATCAAGAAATCCTTACG
TTTGATGTTTGGAGCTAAATTTATCATTTCTTAAAAAATCTGAATATAAGCCAAGTTATT
TGCCTGTTAGAAGACTAAAAAGGATACGAAAAAAGGATAATACTCAACATAATTGTAATA
GTTTTAGTGAATATATTTTTGAAATATCTAAATAAACCTTTTAATATAAAAAAGGATGCT
TTAAAAATGAAGAAATATTTTTTTAAAGGCCAAGATGCTAGACTTATCCCAAAGCAAGAA
TTTATTAGAAGACATGAAGAGTTTAAATAAAGAATGTAAAAATTATATTAAAATAAATGA
TTTTTAAATTAATTTTAATAATAATTAGATAAGAAATAAGTAAAAATGTTAATCCTTAGA
GTGAACTTTATTTCTTTTTGCAAGTGCTTAGTGGCAACATTCAGTTTATACACACCTTCT
GCTAATAAGATTGGATGACTTTTGTTATTTTTTATATACTTTTTGCTAACCCTATATTCA
CAATAGACTAGCTCAAAACTTAAATTCATGAATGGTAAAATATTTATTTCATTCAGAAAA
ATATTATTAAATATTAATTTGATGAATAAAAATATCATTAAATATTAATTTTAGCTATTA
GCATCAAATTGAAAAGAGCGGGGATCACGTTTAACAAATGTTTTTCTATTTGATTACTCA
ATTAGACTGCTATGCTAGTATTCAGAAAGCTTAGGGCATTCTTCATCCTTTCTATTTTTT
CCATTTGATAGATATCTTACAAGTTGCTGAATTCACTTTTGATGACTATACTCCCACATA
CGATTAACTATAGAGAGTAAAATATTTAATCTTAATCTGCTTTACTTCTTCTTAATTTTT
CAATAAACTAAATATCTCAATGCAAAAAATAATTATAATTTGAAAGAATAGCATTTATTT
GTTTCAATAAAGATAAATCTATTATTATTTATCACTTTAAATTTAATAAAACTAATCTTC
AAAATATAAAAAAAGGAATACCTTTTATCAAAATCAAGCACATTTAATAAATAGAAATAA
AATTTCTTCTTAAAATCTTTTTTATTTTTTTAATTTTACAAAATATTTAAAATATATTTT
AAAAAATAATAAATTAATAATTTTGAATATAAATAGAATTTTAGGGAAGAAATTTAGTTT
AAGTTTTTATAATATCTTTAAAATGATATTTTTGACTATCAATTAATGAGCATTTACATC
AACAATTTTGTACAGAGAGTTGATATTATAGATAAGAAACTGAATCACAGCTAAATATTT
GAAGATTTGTTGGTCTCTAAAAGCAACACTGTGAGTAACTTTGCTTAAATAGTCTAAGAT
GTGTAAAAAGAAAAAGATCCTATACTAAATGAAAGTGTTAAAAGCTAAATATCTGCTAAA
GCTATGAGCTTATTGCAATAAAATTAATACGATAAAGCTCTTGAATTTTATATTTAATTA
GCTGATTTCTAAATTGAAGAATGTCCTCCATAAAATGAAGATTTCTAAAAAGTATTAACA
GGCTCTCAATTAAAAAAAATTGAAGAGAATTATAAATATTTGAGAGAGCTTATTGTAAAT
TTATTATTTTAGAGATGTGATGTTGATTTAAAGTCTATTGTAGATTGCTTGGAAAAAAAA
TCTTGTATTATCAATAAGTATTACATTCATACTTAAGTTATAAGAAAGCACCTAAATTTT
TTGTACTCTTATGAAAAACTTGCAGATGCTATTAGTAAGTTAAATAGGGATAATAACTTT
TAAGATAAAAACTTATTAGGATCAATTGAGTAAGACATATACAACCTGATAAAATTGTAA
AACTGTTTATCAAAAGAGCTTGTCATAGGTCTTAGATTAATAGAAACAGTATTAAAAGCA
TCCCAGATAAAGTTGTCATAATAAATTTATAATATTTTAGTGCTCAGAACTTAGTAATTA
ATGAGGGAAATCAAAGAAAACATTATGGAATATGAGTTGTTAAATGATATCTAAAATATT
CAAAGTAAAATTTACAATAAATTATCATTTTATTTAAATTATTTTATAAGTTTATAAATA
GCTAAATCAGGAAATGTAGCACTTTATTTCAATAGTTATGAACAGCTATACATTATGA