Identifiers and Description

Gene Model Identifier

TTHERM_00194800

Standard Name

NUP58

Aliases

PreTt06764 | 16.m00420

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.7%

TetraMine Data

TTHERM_00194800

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03749.12.0002969069156684e-168hypothetical protein (400 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:28386019: Iwamoto M, Osakada H, Mori C, Fukuda Y, Nagao K, Obuse C, Hiraoka Y, Haraguchi T (2017) Compositionally distinct nuclear pore complexes of functionally distinct dimorphic nuclei in the ciliate Tetrahymena. Journal of cell science 130(10):1822-1834

Sequences

>TTHERM_00194800(coding)
ATGTCACTTTTTAATTAGAATTAAGGAGTCTAAATTGGCGGGTAAAAGCCAGGTGGTCTT
TTTTAAACCACCACTACAGGATAGCAAGGAGGTGGTTTATTTAATAATTAGCCTTCTTTA
TAATTAGGCGGAAACTAAACAGGTGGACTACCTGTCTTTGGAGGAAATTAATAACCTGCA
GCAGGAGGAACCATTTTTAATAATCCTATAGGATAGTAAGCTCCAGCTTAAGGTTAAGGT
GGTATTTTTGCTAACTAAAAACCAATAGTCCAAAATTAAACATAAACTAACAATTAATAG
CAAATTTAACATACTGTTTAGTCATAAACATGGAAAGAAGCTAAATAATTGTATTAATAG
CTTTAAAATGTAAAAAAAGAATAAATTTCAATAGAAAGAGATGTAAATGTTAGTGATAAC
AATAATATTTATGCTCATAAACCAGTAAACATTTTGCCTAAAGAATTCTTTGATGAACTG
ACAAATATTAACAAAGATATTTAAAAAACTGAGCAAGATGTAGCCAAACTCGTCGATTCT
TAGAGAGAGCTATTTAATTAAATATAAGAAACAAGAAAAGTTATTTAGCAATCAAGTCTT
TCTTTAAAATAAACTGCATAGTAAGTAAAAGATATTTAAGAAACAGTTAACGAATTGATT
ACAGAGCAATAAGATCAAAAATAATACATCACTAATTTCTTCTATACCTTTACAAATTAC
TTAGAAAACCACTAGTTCCCTCGTCTTATATTGCCTCAACCATTTATTATTAAAGCTCAA
GAAAAATTCTAACTTAAGCTAGAGAAACTTTAACGTCAAATTGATGAAGTAGAGCAAATG
CTTTAAGTAGAAATTTAAAAGAGAAATGATGAAGAAGAATTAGCATTCATATTCGTTATT
GTTGAATAGTTATTCAAATATTTCAATAATGTAACAGCTCTCGTTTATGAATTCCATAAG
CACTACGAAAGTTTCCGTATGAAAATAGTTCATATTCAAGACTAGAGAGAATTTGGATTT
GCCTCTGATCTAAATGAATCAACTAAGCAATCTCTTAATGAAGAGAATCGTTACTTTAAG
CTGCTTTCAAACATTTCAGATAATTTAGAAAAATAAATTAGAAAACATGAAGAAGAACAG
TAAATTAAGCAACCAAACGAAAAAAGAATCTGA


>TTHERM_00194800(protein)
MSLFNQNQGVQIGGQKPGGLFQTTTTGQQGGGLFNNQPSLQLGGNQTGGLPVFGGNQQPA
AGGTIFNNPIGQQAPAQGQGGIFANQKPIVQNQTQTNNQQQIQHTVQSQTWKEAKQLYQQ
LQNVKKEQISIERDVNVSDNNNIYAHKPVNILPKEFFDELTNINKDIQKTEQDVAKLVDS
QRELFNQIQETRKVIQQSSLSLKQTAQQVKDIQETVNELITEQQDQKQYITNFFYTFTNY
LENHQFPRLILPQPFIIKAQEKFQLKLEKLQRQIDEVEQMLQVEIQKRNDEEELAFIFVI
VEQLFKYFNNVTALVYEFHKHYESFRMKIVHIQDQREFGFASDLNESTKQSLNEENRYFK
LLSNISDNLEKQIRKHEEEQQIKQPNEKRI


>TTHERM_00194800(gene)
AAAGGATTAAGGATACATATATATCATAAGATAAATAGATATATATGCCAAATATAAAAA
TCATAAAGTGAATAAGAATATTTAATTTCATTTAATTAAATCTTTATTAATTATTAAACA
AGCTCAAAATTAAAATAATAAAATAAAATAAGTATCAAAATGTCACTTTTTAATTAGAAT
TAAGGAGTCTAAATTGGCGGGTAAAAGCCAGGTGGTCTTTTTTAAACCACCACTACAGGA
TAGCAAGGAGGTGGTTTATTTAATAATTAGCCTTCTTTATAATTAGGCGGAAACTAAACA
GGTGGACTACCTGTCTTTGGAGGAAATTAATAACCTGCAGCAGGAGGAACCATTTTTAAT
AATCCTATAGGATAGTAAGCTCCAGCTTAAGGTTAAGGTGGTATTTTTGCTAACTAAAAA
CCAATAGTCCAAAATTAAACATAAACTAACAATTAATAGCAAATTTAACATACTGTTTAG
TCATAAACATGGAAAGAAGCTAAATAATTGTATTAATAGCTTTAAAATGTAAAAAAAGAA
TAAATTTCAATAGAAAGAGATGTAAATGTTAGTGATAACAATAATATTTATGCTCATAAA
CCAGTAAACATTTTGCCTAAAGAATTCTTTGATGAACTGACAAATATTAACAAAGATATT
TAAAAAACTGAGCAAGATGTAGCCAAACTCGTCGATTCTTAGAGAGAGCTATTTAATTAA
ATATAAGAAACAAGAAAAGTTATTTAGCAATCAAGTCTTTCTTTAAAATAAACTGCATAG
TAAGTAAAAGATATTTAAGAAACAGTTAACGAATTGATTACAGAGCAATAAGATCAAAAA
TAATACATCACTAATTTCTTCTATACCTTTACAAATTACTTAGAAAACCACTAGTTCCCT
CGTCTTATATTGCCTCAACCATTTATTATTAAAGCTCAAGAAAAATTCTAACTTAAGCTA
GAGAAACTTTAACGTCAAATTGATGAAGTAGAGCAAATGCTTTAAGTAGAAATTTAAAAG
AGAAATGATGAAGAAGAATTAGCATTCATATTCGTTATTGTTGAATAGTTATTCAAATAT
TTCAATAATGTAACAGCTCTCGTTTATGAATTCCATAAGCACTACGAAAGTTTCCGTATG
AAAATAGTTCATATTCAAGACTAGAGAGAATTTGGATTTGCCTCTGATCTAAATGAATCA
ACTAAGCAATCTCTTAATGAAGAGAATCGTTACTTTAAGCTGCTTTCAAACATTTCAGAT
AATTTAGAAAAATAAATTAGAAAACATGAAGAAGAACAGTAAATTAAGCAACCAAACGAA
AAAAGAATCTGA