Identifiers and Description

Gene Model Identifier

TTHERM_00091620

Standard Name

NUP308

Aliases

PreTt16515 | 6.m00589 | 3836.m02175 | Nup308

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00091620

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02524.19.997093137033517e-262hypothetical protein (2551 aa)
DictyBaseDDB_G02913902.9992476920535046e-16nup98 on chromosome: 6 positio
n 239658 to 246409
SGDYMR047C0.0000000029989608248573072NUP116 Subunit of the Nup82 su
bcomplex of the nuclear pore c
omplex; localized to both side
s of the pore; contains a repe
titive GLFG motif that interac
ts with mRNA export factor Mex
67p and with karyopherin Kap95
p; homologous to Nup100p
WormBaseWBGene000037970.000000030002053728821195locus:npp-11 status:Partiall
y_confirmed UniProt:O01576
protein_id:CCD66423.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:28386019: Iwamoto M, Osakada H, Mori C, Fukuda Y, Nagao K, Obuse C, Hiraoka Y, Haraguchi T (2017) Compositionally distinct nuclear pore complexes of functionally distinct dimorphic nuclei in the ciliate Tetrahymena. Journal of cell science 130(10):1822-1834
  2. Ref:19375312: Iwamoto M, Mori C, Kojidani T, Bunai F, Hori T, Fukagawa T, Hiraoka Y, Haraguchi T (2009) Two distinct repeat sequences of Nup98 nucleoporins characterize dual nuclei in the binucleated ciliate tetrahymena. Current biology : CB 19(10):843-7

Sequences

>TTHERM_00091620(coding)
ATGGCAGCAAATACAGGAGGAGGTTTATTTGGAGGACAATAGACTTAATAAAATTAGGGT
TTATTTGGAGGACAATAGACTTAATAAAACTCGAGCTTATTTGGAGGTCAATAAGCATAA
AACTAATAACAAGGTTAGGGCGCATAAGGATAATAACAAGCTTTCTCTTTATTTACCAAC
AATTAATAAGGCTAAAATAATCAATAAGCAAGTTCTAATTAATAAAATATATTTGGTGGT
GCTATATAATAACAATAAGGAGGAGGAAACTTATTTGGCTAAACTCAATAAAGTTAATAG
TAAGGTACTGGTCAACCATCAGGATTATTCGGGGGTATAGGTAATATGAATTAATAGCCA
GCAGCTAAGTAAAATGAAACACCAGTCCCTCCTTAAACTCAAAATTAATTGTTTGCAAAT
ATATAGAATTAATAGTAGCCTCCTTAATAATAAACTTAAAACTAAGGTTAATAATCTTAA
TAGTAGCAACAATAACCAACAAGCACAAATGGCTTATTTGGAAATGTTTAGTTAGGAGCA
TCAAATTAAAATCAGGCTTAAAACAATACCCAAAATTAGTAAGCTGAAAAGCCAAATTCT
CTTTTTGGAGATAAGCAAAATCAAGGAGCTCCATAAGTCACAGGAGGCTTATTTGGTAAC
TCTGCTAATTAAGGCACAGGAATGCAAATCAATACTAATAAACCAGCAACATCAGGTTTA
TTTGGAGCCAATTAAACAGATTAATAGTAAAATAAACCTATAGGAGGAGGAATCTTTAAT
TAAATGTAATAAAATGCCTAAAGCTAATAGACCCAATAGTAATAATAACCTCCCACATAA
ACTGGTGGTGGCTTATTCGGTTAGACATAATAATAGTAGTAAACTAATGCTCCTCCTAAA
GAAGAACCAAAGACATCTTTAGGTGGATTAAATTTATTAGGTTAAGCTCCTTTAAATACT
TAAAACTAGTAGAATTAAGCCCCAAAATAACCTGCATAAAGTGGCGGCTTATTTGCTTAG
GCTCCATAATAACAATAATAATAACAACAACAACAACAATAAAATAATACATAACCAACT
ACAACAACTACAATTCCTTCTACAAATTCTTTGTTTAATAATGCACCAAATACATAAGCT
GGTGCAACTACTACTTAAACAGCATAAACTACATAAACAGCAGCAGCTCCTCCTAAAAGT
TAGGGACCAAGTTTATTTGCATAAAATAACTAACAAACAGCACAACCACCAGCTAATTCA
CAACCAACTTAGTAAGGATAAACATAAGGAGGAGGTCTATTTGGTGCTAACATAGATGCT
TAAAATGCTGGAAGTAGCTAACCTAAGTTTTTAAATATAGGAGCTAATAAAGATAATATA
TTAGGTTAAGGAAAGACAAACTAACCTGAAGGACTCAATATCGGTGGAGGATAAAAAGGT
ATCCTGACAGGTGCCTCTGGAGCAGCAGCAACTACTACTACTACCGCAGCATCTACTACT
GATGCTACTAAACCAGCTCAACCCTCAATCTTAACTGGATAAACTCAAGCAGCCTCTAGC
CTTTTAGGAGGATAATAAAAACCAGCAACTAATCCTCCTACTATAGGAGCTACCTCTTAA
ACTACTGGTGGCTTAGTAGGAACAGGTTTAGCAGGTCAATCAAATTAAATTCCAGCTCCC
AAAAAAACTCATTAACATACTTCTTAAGCAACTGGACCAGATGAGAGATTAGAAATGGAT
ATTAATTCTGCTAAAAATCTTAATGGAAGTTTACACATGTTTTGCCAAAATATCCATAAG
TATAAACCTGAGCATGTTAAAAAATTCTTTTCTAATGAGGACATTTTCAATAAATTAACA
TAAGGTCTTCAAATATATAAAGGAGAACAAAATACAGATTAATGGGAGAATATAAAAAAG
GAAGCCAAGGAAGGAAAGACTCCTTTGAAGTTCTGGAGTGAGAGATTATCAAAATATAAA
TATTAGTATTTGATTGTTATGTTTATTGAAGATATTGCTGAATATCTTTAAATTAAACCT
ATGGATTGTTACCGTATGTTTGATGTTTTCCTTTCTCACGAGAGCAAATTTGTCGACTAT
TTCTTCAATCCTTCTTCTAATGAACCTTGCATCGAATTTTTCTACGAATAACAAGCTATT
TTATTTGAATCTAACAATGTTGCAGTAAGAAAGGACTCTCCATTTATAATTAATTTGAAA
ACTTCTTTTATGAAAGACATTTATTTCCATGAACGTAACTGCATACTTGCCTCCCTCCGT
CTTCTTTTACTTTTCACTGATGACCAATACAATTACGATGCTGTTAGAGATGTTGTCGCT
CGTCTCTTAAGAAACAAATTAGAAGAGTCTTTATGGGAATAATATGCTGGATAAAACAAT
AATCCTGAATTAAGTGCAGAAGATAGCGAGCTATTCTAACTTTAAAAATAATTTGAAAAC
GACTAAATCATTAAGCTTTTATTCATTATCACTTAAAAAAATCAAAGCAAAATTAGCATA
GAAACCTATTTACAAAAATTCAATAGCTAAAACTTCATGGGTAATTGGTAAAATTTACAA
CCTCAAAATGAAAACACCTTTGAAAATAAAAATAAAATTAACGAGTTATCAACAGTAGTT
GGTGATTCTTGTTTGATGTTAGTATTTGCTAAAGTAAAAGAAATTTAATAAAATAAAAAC
AAAAATGAAAAAGATGCATTTGAAAAGATATTTAAACAATCTTAAACTAGCTCTTAGAAG
AGCTAATAAATGAATGTTTTAAAGCTTTACTATGACTCTATAAGCTAAGAATAATTGGTT
GTTGAATTTTATGAATAAATTGAATATCTCTACAAAACTATTGTTAGAATTCTTAATTAT
AAGAATTTGGGAACTCTCAAAACTTAATGGTAGGAAATATTCTTTGAATTGCTCGTAAAG
ATTATTTAAGGAATTAACGCAAATGAATTCTATGAAGAAATGGATGAATAGCTAGAATCT
TTCATTAGTGAATGCATTTGTATTGCATTTTCTAAAACTATACACAAAAATCCTAAATTA
ATTGACTTATTCTGGGAAAAGCTCGAAAGCAGAGAACAAACTAAGCATTTCCAAAATATC
TTTTCTAGTCCTATTTCTATTTACAAAGTAATGAAAAGTGCACTAGGTATGAGCTCCGAC
CCTAAATCTCGTCATGTTATCATCTTTTTGACTACTTTAAGCAATTTTAATTGGATTAAC
TTTAACTAAATAGCTGACTCACAATAAAATTTAGATACTGCAAGCATATTAAAATTGAGA
TTAATTTATAAGCTTATAATTACTGATCCTAAATGCATTAATTTACTTTAATATGTATTT
TACTTCACTGATTTATCATAGAATACTTTCGATTAATACATAAATGAATGCAATGGTGAT
GAAGTAATTAAATTTGTGATAAAGAGTTTTGCATTATATAACGATTTGCGTAGCTATGCT
TATTAAAACTTCTTTGCTGGTCTTAAGGCCTTAAATGTATTGCTCAACAATCACTAATAC
TAGACACAATAAATTTTGTAAATCGAAGAATATTAAGATTTGCTCTTCAAAGAATATAGA
CGTTTAGCAATATAAAATGATGTGACTGCCACTGAATACAGATTAAAATGCAAGAGAGAA
ATCTTAAATATCTTATACACTATTTTAAAGGATTTCGAAGAGCCTTTGCTTGCTTTCTCT
CAAATAAAAGGAATGGAAAGAAACACAGAATATGATTCTCCTTTACTTGCTCATTTGTTC
CTCTTCTTCACTAGCTTTATTGAAGATTGGGAATAAAACTAAGGCGCTCTTTACCTTAAG
CATAAGTGGAAAATAGGCTCTTTAATCATGAAAATTACTGATATTTGTTTAAACAGATTA
TCAATAAATGTCTATAAGAAACAAGACTTCAGACCTGTTTAAAGTGATAGCTATACTAGC
TTTTTCTTACACAACTTCCTCTGCAACTAATTAAAGAAAATCAGAGTAGATGAAATGATT
ATCAAGGTGCTTGAAGTAGCAGCTAACTAATCATCTATTAGTAACAACAAGATAAACAAC
AAAACTCTTAAATTGAATAACAAGTATTGGTAAACTTATATCATGAATACCTCAAATAAA
TTTAAAGAACACTAGGTTGAACACATTAAAAACTAAGTTAATTTAAGAAATCTGATTGTT
GACACATTGAAGGTGTTAGAAACTACTATGCAATTAATTGAATAAAAAATTTAAATCCGT
AAACAAGATTTCGAATATAGATTTTTACAGAAATCAATGCTTTTAGATGAAATCCCAATT
TTAGATTTCTTTGAAAGAATAATATGCAAATCTGACTGTATCTTCCATTACAAATAAGAA
TATTACATTGACTCAAGCTTAAACTCAATAAAAATAAATATTTTATACGCCATATCCTCT
TACATTAACTTTGAAAATCATTTCTACTCTTCAAACGATGAAGTTAACCCAACACTTCCC
TTTTATATTTACAATTTCTTGGAAAGTGAAGGTAATTTAATTAACTAATTGGCAGATACT
CATTACCTTCTCGACTATGACACTATTAGAAACCCATTAAATAATTCTCGTTTACCAAAT
GGTACTTACTGTGAATTGATTAGCTCTTTGAGTTTGAGAATTTTAACTTAAATCATGTTG
GCTTGGGAAGCTCAATAGTCAATTAGAAAACCTATTTTAGTAGATTTCTTAAGCAACATG
AATATGGAAAACTACTGGGAGAAGTTAAATTACTCTTCTATTAACACTTAATTAACTAAT
TTCATAATTGAGATGTTTAACATATTGAAATTGAATGAATATGATTCTAACAATGATAGT
GAAGCTCTCAGAAAAAACATATCAGACAACAGCTGTGCAGTTATCGATTTCATGCTCACT
GCCTTATACACTCAACCTCTCTTCATGAACTTGATTCTTAAACCTGATAATCTTAACAGA
AAAAAGAAAGATAATGATCTTAAAATCAGATTTAAGCGCTTCTTTGAATCAAATGTTTGC
ACTTATGACATGCGTTTACTCAACAAATATTTGAATCTTTTAGTTGAAATCTTTAAGAGA
GATTAAATGTACCCAAGCTTTTGTTAGGAATTCCGTTAAGACACACAATATATTTTCGAA
AAGATTACTAAAGTCGTAGTTTAAAACTTTAAACCTTATGAAATCGACTAGCTCGTTGAA
AGAGATCTTTACTTTTTAAATTCTCCCAAAGAACCAAATATTCCTTACTTCGAGTTCTAA
AAATTAAAGTTATCTCAATTACTTAGAGAACACATAAAATAAACAGAACTCTACTAATAG
ATGATTTGCTTACACAGTTTCTAGATTTTACTTGATTTAATTAGCAAAGAATATCTTTCC
AATAAATGTAAATCAGTCCAATCTATCCAAAATAGCTTAAAAGCAATATTCGAAAATAAA
TAAGTTAATCACATCATGAACAGCTTATCTAAGTTCGCTCCAAGCTATTCATTAGATCTT
TGGCCAGTTCCTCAATAAATTCAAACTAAGATGAACATTGAAAATGAAGAGTAATTTAAG
GGAAAAATTTTCTAATAATCTTTCTTCTATTTGTTGGAAACTAACCAATATTCATATGGA
AGAGGATATGCTTTGGATGCCAGTGAGATTATATTCAATAAAATAGACGCTGAAAGACCT
TAAGACTACTTGTCTAGAGCTAAATACATTCTCTTTAAATTAATTGAATTCCGTCAAAAG
AGTATTAAATGGTCTATTGAAGAAATAAAACTAAGGACATTTGATTCATGGATTAGACTA
TTTTGTTTAGTTACTTCTTCAGGAGTTGAAGGTTACGCTATGAGTACTGTACAATCTTCT
ATTCCAAATTTCACTCTTAAGTAGCTCAGAGAGAGAAAGATTATTTTAGAGCATGAATAA
TTATGTTTACTCTATCCTAACTATGAAATAGAGTTTGTGAGTGGATTTGTTAACATCTTC
TGTGCCTCTAACCCACAATGTGTTGGTCTTTTCTCTAACTTATAGAGCGAAATGATGAAA
TAAATTCTCTAAGATTTGAAAAAAGGGTACTTTGGAGTGCTCTTTGATCAAAAACTCAAA
TTTTTACTTTACATATTATTCTCACTCAGACACTTACAAGATCTAGACTACCATTCCAAA
GAGTCAGAAAATAAAAAGACATAAAATCCTAATAATTTTATTGGTAGATCAAACTAAAAT
CAAGAAAGCTAACATTCTTTCTCAGATTCTTATAAAAAAGAAGAAGCCGAAGATTTATTC
AAAGTAATGACATAAATTTTAGAAGAAGCTGTCCATCGTGGTACTAGAGTTCAAATATGT
GATTTCATTTAGTGCTTATTCTTGCAATTACAAGTGATGGAAGTTCTCTACTTATAAACC
TTCTAAAACAACAAGAAAAAATTCGTTATCAATGAAAACTTGAATCCTTACTTTACAAAA
ATAATTGGTATTTTAATGAATTTGGCTGCTTAGAATATTGATGGTCTCCCTATTTTAATA
TCTTGTCTTAACAGTGCCCTACATATCTATCCATAATACTTTATTCTTTAATTCAAATAT
CAAGTTAAAGCTTTAGAATTTTTGATTAATAAAATCTTTTATGAAAAGAATGAAACTGCT
TAAATCTTTGTTTCTATTATAAATCTGTTGACAGATATTGCTAAGTATCCTGAAGGTGCT
CTTTTATTGAGTGAAGCTAATATTGTAAGTATGATATGCAACACTCCCATTTTTAAGAAT
ATAGAAAATGAACCATTCTATTGGCAAAATGGAGAAAGAAATCTCTTACATTCTTTCTGG
TGTTGGAGTTTGAATTTCTATAAGGAATATATAATTTCATTGCCTTCAGATTTAGAAAAC
ACAACTTCATCTTTCTAATTCTTATAGACTTATTTCACTCGTATTGCTAAAATTCTCTCT
ATTCCTCAAGTTTTATAAAACACTGCTACAAATTTAGCTAATAACAAAATGATTAACACT
GAATAAGAAAAGCTTTCTCTTGCATATATGGAAGAAATCGAACTTATTTTGGAACTTCTC
TCAGTTTATTTCTGCCAAGCCAATATCTTCAAAAGAAAGATGAGCAACGATTTTGAATAA
ATACTTCAATTCTTGACTCATTGCACTATTTGCTTATTTAAGTAGGGTCTTTCCATCCAA
TCTATCTTCATGCCAGTTTCTAAAATGGAAAAGAAGCTCTCTCAAATTTATGACATTTAT
CAGGTCAGCTCAGCAGACAGTGCTCACTTATATCACACATCTATACTTACTCCTTCTCAT
ACTCCAAACAAATAAGAGTTAGAAGCAGGCATCTCTACAGCTCACTCTGCTATTGGAGAT
ACAAAAAATAAGAACTATAACTTATTCATCATTTAAGTTGAATTACACTACTAGAGCATT
TTATTCAGTTTGTTTTCTTGTATCTAAGACGGTTTACAAGAATCAAGTTTACTTTAATTA
TTCTAATATTCTAGCAACAGCTTCAGTGATAATTTGATCAATAATGAAAGCAAGTAAGTT
TATTCTGTAAATTACTGGTAGAGCTTTGCAAATTCTTTGTTTGACTGCCTTAAATTCGTA
GAAAATACTCTAAATAAATGGGATTATAAGAAAAATAAAAATGTTAATATGGATGACTAG
CTTGTCAAGCTTCGCGCTCTCACAAATTCTGTAGAGTATAACTTATGTTGCTATGGATTT
GGTTCTCAAACTTCTTTAATAAATAGTGCTAAAACAATTATTTAAACATCTTAATTTAGT
CTTTAAGCTATCGTTCTTTCTGCTATCAAGCACTTCTAAATGTTAAACGAATTCAAATAA
TGGTTTGGACACTCTATAAAAGACAGTTTAACTGATTTATAAAATAAATTAAATGCAAAG
CTAGATGGATTGAAGAAACTAGAATATGAAGATATTTAACTTAAAAAATAAATTGAAGAG
CATATTTTACAATTCTAAAGGCTATCAGTGACATAAGATAGATATTGA


>TTHERM_00091620(protein)
MAANTGGGLFGGQQTQQNQGLFGGQQTQQNSSLFGGQQAQNQQQGQGAQGQQQAFSLFTN
NQQGQNNQQASSNQQNIFGGAIQQQQGGGNLFGQTQQSQQQGTGQPSGLFGGIGNMNQQP
AAKQNETPVPPQTQNQLFANIQNQQQPPQQQTQNQGQQSQQQQQQPTSTNGLFGNVQLGA
SNQNQAQNNTQNQQAEKPNSLFGDKQNQGAPQVTGGLFGNSANQGTGMQINTNKPATSGL
FGANQTDQQQNKPIGGGIFNQMQQNAQSQQTQQQQQPPTQTGGGLFGQTQQQQQTNAPPK
EEPKTSLGGLNLLGQAPLNTQNQQNQAPKQPAQSGGLFAQAPQQQQQQQQQQQQNNTQPT
TTTTIPSTNSLFNNAPNTQAGATTTQTAQTTQTAAAPPKSQGPSLFAQNNQQTAQPPANS
QPTQQGQTQGGGLFGANIDAQNAGSSQPKFLNIGANKDNILGQGKTNQPEGLNIGGGQKG
ILTGASGAAATTTTTAASTTDATKPAQPSILTGQTQAASSLLGGQQKPATNPPTIGATSQ
TTGGLVGTGLAGQSNQIPAPKKTHQHTSQATGPDERLEMDINSAKNLNGSLHMFCQNIHK
YKPEHVKKFFSNEDIFNKLTQGLQIYKGEQNTDQWENIKKEAKEGKTPLKFWSERLSKYK
YQYLIVMFIEDIAEYLQIKPMDCYRMFDVFLSHESKFVDYFFNPSSNEPCIEFFYEQQAI
LFESNNVAVRKDSPFIINLKTSFMKDIYFHERNCILASLRLLLLFTDDQYNYDAVRDVVA
RLLRNKLEESLWEQYAGQNNNPELSAEDSELFQLQKQFENDQIIKLLFIITQKNQSKISI
ETYLQKFNSQNFMGNWQNLQPQNENTFENKNKINELSTVVGDSCLMLVFAKVKEIQQNKN
KNEKDAFEKIFKQSQTSSQKSQQMNVLKLYYDSISQEQLVVEFYEQIEYLYKTIVRILNY
KNLGTLKTQWQEIFFELLVKIIQGINANEFYEEMDEQLESFISECICIAFSKTIHKNPKL
IDLFWEKLESREQTKHFQNIFSSPISIYKVMKSALGMSSDPKSRHVIIFLTTLSNFNWIN
FNQIADSQQNLDTASILKLRLIYKLIITDPKCINLLQYVFYFTDLSQNTFDQYINECNGD
EVIKFVIKSFALYNDLRSYAYQNFFAGLKALNVLLNNHQYQTQQILQIEEYQDLLFKEYR
RLAIQNDVTATEYRLKCKREILNILYTILKDFEEPLLAFSQIKGMERNTEYDSPLLAHLF
LFFTSFIEDWEQNQGALYLKHKWKIGSLIMKITDICLNRLSINVYKKQDFRPVQSDSYTS
FFLHNFLCNQLKKIRVDEMIIKVLEVAANQSSISNNKINNKTLKLNNKYWQTYIMNTSNK
FKEHQVEHIKNQVNLRNLIVDTLKVLETTMQLIEQKIQIRKQDFEYRFLQKSMLLDEIPI
LDFFERIICKSDCIFHYKQEYYIDSSLNSIKINILYAISSYINFENHFYSSNDEVNPTLP
FYIYNFLESEGNLINQLADTHYLLDYDTIRNPLNNSRLPNGTYCELISSLSLRILTQIML
AWEAQQSIRKPILVDFLSNMNMENYWEKLNYSSINTQLTNFIIEMFNILKLNEYDSNNDS
EALRKNISDNSCAVIDFMLTALYTQPLFMNLILKPDNLNRKKKDNDLKIRFKRFFESNVC
TYDMRLLNKYLNLLVEIFKRDQMYPSFCQEFRQDTQYIFEKITKVVVQNFKPYEIDQLVE
RDLYFLNSPKEPNIPYFEFQKLKLSQLLREHIKQTELYQQMICLHSFQILLDLISKEYLS
NKCKSVQSIQNSLKAIFENKQVNHIMNSLSKFAPSYSLDLWPVPQQIQTKMNIENEEQFK
GKIFQQSFFYLLETNQYSYGRGYALDASEIIFNKIDAERPQDYLSRAKYILFKLIEFRQK
SIKWSIEEIKLRTFDSWIRLFCLVTSSGVEGYAMSTVQSSIPNFTLKQLRERKIILEHEQ
LCLLYPNYEIEFVSGFVNIFCASNPQCVGLFSNLQSEMMKQILQDLKKGYFGVLFDQKLK
FLLYILFSLRHLQDLDYHSKESENKKTQNPNNFIGRSNQNQESQHSFSDSYKKEEAEDLF
KVMTQILEEAVHRGTRVQICDFIQCLFLQLQVMEVLYLQTFQNNKKKFVINENLNPYFTK
IIGILMNLAAQNIDGLPILISCLNSALHIYPQYFILQFKYQVKALEFLINKIFYEKNETA
QIFVSIINLLTDIAKYPEGALLLSEANIVSMICNTPIFKNIENEPFYWQNGERNLLHSFW
CWSLNFYKEYIISLPSDLENTTSSFQFLQTYFTRIAKILSIPQVLQNTATNLANNKMINT
EQEKLSLAYMEEIELILELLSVYFCQANIFKRKMSNDFEQILQFLTHCTICLFKQGLSIQ
SIFMPVSKMEKKLSQIYDIYQVSSADSAHLYHTSILTPSHTPNKQELEAGISTAHSAIGD
TKNKNYNLFIIQVELHYQSILFSLFSCIQDGLQESSLLQLFQYSSNSFSDNLINNESKQV
YSVNYWQSFANSLFDCLKFVENTLNKWDYKKNKNVNMDDQLVKLRALTNSVEYNLCCYGF
GSQTSLINSAKTIIQTSQFSLQAIVLSAIKHFQMLNEFKQWFGHSIKDSLTDLQNKLNAK
LDGLKKLEYEDIQLKKQIEEHILQFQRLSVTQDRY


>TTHERM_00091620(gene)
ATGGCAGCAAATACAGGAGGAGGTTTATTTGGAGGACAATAGACTTAATAAAATTAGGGT
TTATTTGGAGGACAATAGACTTAATAAAACTCGAGCTTATTTGGAGGTCAATAAGCATAA
AACTAATAACAAGGTTAGGGCGCATAAGGATAATAACAAGCTTTCTCTTTATTTACCAAC
AATTAATAAGGCTAAAATAATCAATAAGCAAGTTCTAATTAATAAAATATATTTGGTGGT
GCTATATAATAACAATAAGGAGGAGGAAACTTATTTGGCTAAACTCAATAAAGTTAATAG
TAAGGTACTGGTCAACCATCAGGATTATTCGGGGGTATAGGTAATATGAATTAATAGCCA
GCAGCTAAGTAAAATGAAACACCAGTCCCTCCTTAAACTCAAAATTAATTGTTTGCAAAT
ATATAGAATTAATAGTAGCCTCCTTAATAATAAACTTAAAACTAAGGTTAATAATCTTAA
TAGTAGCAACAATAACCAACAAGCACAAATGGCTTATTTGGAAATGTTTAGTTAGGAGCA
TCAAATTAAAATCAGGCTTAAAACAATACCCAAAATTAGTAAGCTGAAAAGCCAAATTCT
CTTTTTGGAGATAAGCAAAATCAAGGAGCTCCATAAGTCACAGGAGGCTTATTTGGTAAC
TCTGCTAATTAAGGCACAGGAATGCAAATCAATACTAATAAACCAGCAACATCAGGTTTA
TTTGGAGCCAATTAAACAGATTAATAGTAAAATAAACCTATAGGAGGAGGAATCTTTAAT
TAAATGTAATAAAATGCCTAAAGCTAATAGACCCAATAGTAATAATAACCTCCCACATAA
ACTGGTGGTGGCTTATTCGGTTAGACATAATAATAGTAGTAAACTAATGCTCCTCCTAAA
GAAGAACCAAAGACATCTTTAGGTGGATTAAATTTATTAGGTTAAGCTCCTTTAAATACT
TAAAACTAGTAGAATTAAGCCCCAAAATAACCTGCATAAAGTGGCGGCTTATTTGCTTAG
GCTCCATAATAACAATAATAATAACAACAACAACAACAATAAAATAATACATAACCAACT
ACAACAACTACAATTCCTTCTACAAATTCTTTGTTTAATAATGCACCAAATACATAAGCT
GGTGCAACTACTACTTAAACAGCATAAACTACATAAACAGCAGCAGCTCCTCCTAAAAGT
TAGGGACCAAGTTTATTTGCATAAAATAACTAACAAACAGCACAACCACCAGCTAATTCA
CAACCAACTTAGTAAGGATAAACATAAGGAGGAGGTCTATTTGGTGCTAACATAGATGCT
TAAAATGCTGGAAGTAGCTAACCTAAGTTTTTAAATATAGGAGCTAATAAAGATAATATA
TTAGGTTAAGGAAAGACAAACTAACCTGAAGGACTCAATATCGGTGGAGGATAAAAAGGT
ATCCTGACAGGTGCCTCTGGAGCAGCAGCAACTACTACTACTACCGCAGCATCTACTACT
GATGCTACTAAACCAGCTCAACCCTCAATCTTAACTGGATAAACTCAAGCAGCCTCTAGC
CTTTTAGGAGGATAATAAAAACCAGCAACTAATCCTCCTACTATAGGAGCTACCTCTTAA
ACTACTGGTGGCTTAGTAGGAACAGGTTTAGCAGGTCAATCAAATTAAATTCCAGCTCCC
AAAAAAACTCATTAACATACTTCTTAAGCAACTGGACCAGATGAGAGATTAGAAATGGAT
ATTAATTCTGCTAAAAATCTTAATGGAAGTTTACACATGTTTTGCCAAAATATCCATAAG
TATAAACCTGAGCATGTTAAAAAATTCTTTTCTAATGAGGACATTTTCAATAAATTAACA
TAAGGTCTTCAAATATATAAAGGAGAACAAAATACAGATTAATGGGAGGTAAATTGATTT
AAAAAATATGAATTGAAGCAATTTATTAATTAGCATAAAAGTTTACTCAAATTTCTTAAT
TTGAAATACTAAAATTAGCACAATAATAAATTTAATTGGTTTATTAAAAAAAACAAGAAT
GATTTGGTTATTTTTTATTTAAAATTTTTTAATAGAATATAAAAAAGGAAGCCAAGGAAG
GAAAGACTCCTTTGAAGTTCTGGAGTGAGAGATTATCAAAATATAAATATTAGTATTTGA
TTGTTATGTTTATTGAAGATATTGCTGAATATCTTTAAATTAAACCTATGGATTGTTACC
GTATGTTTGATGTTTTCCTTTCTCACGAGAGCAAATTTGTCGACTATTTCTTCAATCCTT
CTTCTAATGAACCTTGCATCGAATTTTTCTACGAATAACAAGCTATTTTATTTGAATCTA
ACAATGTTGCAGTAAGAAAGGACTCTCCATTTATAATTAATTTGAAAACTTCTTTTATGA
AAGACATTTATTTCCATGAACGTAACTGCATACTTGCCTCCCTCCGTCTTCTTTTACTTT
TCACTGATGGTATAACAATTAAAAATTTAATAATTTAATCTCATTATTTAACAAATATTA
TTTTAAGACCAATACAATTACGATGCTGTTAGAGATGTTGTCGCTCGTCTCTTAAGAAAC
AAATTAGAAGAGTCTTTATGGGAATAATATGCTGGATAAAACAATAATCCTGAATTAAGT
GCAGAAGATAGCGAGCTATTCTAACTTTAAAAATAATTTGAAAACGACTAAATCATTAAG
CTTTTATTCATTATCACTTAAAAAAATCAAAGCAAAATTAGCATAGAAACCTATTTACAA
AAATTCAATAGCTAAAACTTCATGGGTAATTGGTAAAATTTACAACCTCAAAATGAAAAC
ACCTTTGAAAATAAAAATAAAATTAACGAGTTATCAACAGTAGTTGGTGATTCTTGTTTG
ATGTTAGTATTTGCTAAAGTAAAAGAAATTTAATAAAATAAAAACAAAAATGAAAAAGAT
GCATTTGAAAAGATATTTAAACAATCTTAAACTAGCTCTTAGAAGAGCTAATAAATGAAT
GTTTTAAAGCTTTACTATGACTCTATAAGCTAAGAATAATTGGTTGTTGAATTTTATGAA
TAAATTGAATATCTCTACAAAACTATTGTTAGAATTCTTAATTATAAGAATTTGGGAACT
CTCAAAACTTAATGGTAGGAAATATTCTTTGAATTGCTCGTAAAGATTATTTAAGGAATT
AACGCAAATGAATTCTATGAAGAAATGGATGAATAGCTAGAATCTTTCATTAGTGAATGC
ATTTGTATTGCATTTTCTAAAACTATACACAAAAATCCTAAATTAATTGACTTATTCTGG
GAAAAGCTCGAAAGCAGAGAACAAACTAAGCATTTCCAAAATATCTTTTCTAGTCCTATT
TCTATTTACAAAGTAATGAAAAGTGCACTAGGTATGAGCTCCGACCCTAAATCTCGTCAT
GTTATCATCTTTTTGACTACTTTAAGCAATTTTAATTGGATTAACTTTAACTAAATAGCT
GACTCACAGTAATAAATATTTATTTAATTTATTAATTATTTAATTTAATTTGTTTTTGAA
TAGATAAAATTTAGATACTGCAAGCATATTAAAATTGAGATTAATTTATAAGCTTATAAT
TACTGATCCTAAATGCATTAATTTACTTTAATATGTATTTTACTTCACTGATTTATCATA
GAATACTTTCGATTAATACATAAATGAATGCAATGGTGATGAAGTAATTAAATTTGTGAT
AAAGAGTTTTGCATTATATAACGATTTGCGTAGCTATGCTTATTAAAACTTCTTTGCTGG
TCTTAAGGCCTTAAATGTATTGCTCAACAATCACTAATACTAGACACAATAAATTTTGTA
AATCGAAGAATATTAAGATTTGCTCTTCAAAGAATATAGACGTTTAGCAATATAAAATGA
TGTGACTGCCACTGAATACAGATTAAAATGCAAGAGAGAAATCTTAAATATCTTATACAC
TATTTTAAAGGATTTCGAAGAGCCTTTGCTTGCTTTCTCTCAAATAAAAGGAATGGAAAG
AAACACAGAATATGATTCTCCTTTACTTGCTCATTTGTTCCTCTTCTTCACTAGCTTTAT
TGAAGATTGGGAATAAAACTAAGGCGCTCTTTACCTTAAGCATAAGTGGAAAATAGGTAA
TCAATTTTTATTTCGATTTTTCTTTAATTAAAAAAAAATTTTATAAAGAAATACTTTTTT
AAACTTTTTCTTCAAAAAATTCTTTTAGGCTCTTTAATCATGAAAATTACTGATATTTGT
TTAAACAGATTATCAATAAATGTCTATAAGAAACAAGACTTCAGACCTGTTTAAAGTGAT
AGCTATACTAGCTTTTTCTTACACAACTTCCTCTGCAACTAATTAAAGAAAATCAGAGTA
GATGAAATGATTATCAAGGTGCTTGAAGTAGCAGCTAACTAATCATCTATTAGTAATAAA
TAAATAAATCAACAATAAAATTTTATTCAATTAATTTTAATATCTAATAGGTAACAACAA
GATAAACAACAAAACTCTTAAATTGAATAACAAGTATTGGTAAACTTATATCATGAATAC
CTCAAATAAATTTAAAGAACACTAGGTTGAACACATTAAAAACTAAGTTAATTTAAGAAA
TCTGATTGTTGACACATTGAAGGTGTTAGAAACTACTATGCAATTAATTGAATAAAAAAT
TTAAATCCGTAAACAAGATTTCGAATATAGATTTTTACAGAAATCAATGCTTTTAGATGA
AATCCCAATTTTAGATTTCTTTGAAAGAATAATATGCAAATCTGACTGTATCTTCCATTA
CAAATAAGAATATTACATTGACTCAAGCTTAAACTCAATAAAAATAAATATTTTATACGC
CATATCCTCTTACATTAACTTTGAAAATCATTTCTACTCTTCAAACGATGAAGTTAACCC
AACACTTCCCTTTTATATTTACAATTTCTTGGAAAGTGAAGGTAATTTAATTAACTAATT
GGCAGATACTCATTACCTTCTCGACTATGACACTATTAGAAACCCATTAAATAATGTATA
TTTAAATTCTTAAAAATATAAACAATATTTTGATGAAATTATTATTTAAATAAATCTTAG
TCTCGTTTACCAAATGGTACTTACTGTGAATTGATTAGCTCTTTGAGTTTGAGAATTTTA
ACTTAAATCATGTTGGCTTGGGAAGTAAATAAATTAATTAATTTTCATTCAATTTCAAAG
TGTTTAAATTATTATATTTATTATAGGCTCAATAGTCAATTAGAAAACCTATTTTAGTAG
ATTTCTTAAGCAACATGAATATGGAAAACTACTGGGAGAAGTTAAATTACTCTTCTATTA
ACACTTAATTAACTAATTTCATAATTGAGATGTTTAACATATTGAAATTGAATGAATATG
ATTCTAACAATGATAGTGAAGCTCTCAGAAAAAACATATCAGACAACAGCTGTGCAGTTA
TCGATTTCATGCTCACTGCCTTATACACTCAACCTCTCTTCATGAACTTGATTCTTAAAC
CTGATAATCTTAACAGAAAAAAGAAAGATAATGATCTTAAAATCAGATTTAAGCGCTTCT
TTGAATCAAATGTTTGCACTTATGACATGCGTTTACTCAACAAAGTAAAATATCAAATAA
ATATTTAAAACAAATTCATCAAAATATCTTCTTTTTTTTTATAAAAGTATTTGAATCTTT
TAGTTGAAATCTTTAAGAGAGATTAAATGTACCCAAGCTTTTGTTAGGAATTCCGTTAAG
ACACACAATATATTTTCGAAAAGATTACTAAAGTCGTAGTTTAAAACTTTAAACCTTATG
AAATCGACTAGCTCGTTGAAAGAGATCTTTACTTTTTAAATTCTCCCAAAGAACCAAATA
TTCCTTACTTCGAGTTCTAAAAATTAAAGTTATCTCAATTACTTAGAGAACACATAAAAT
AAACAGAACTCTACTAATAGATGATTTGCTTACACAGTTTCTAGATTTTACTTGATTTAA
TTAGCAAAGAATATCTTTCCAATAAATGTAAATCAGTCCAATCTATCCAAAATAGCTTAA
AAGCAATATTCGAAAATAAATAAGTGTAATGAATCAATTATTTGAATTAATGTTTTTTAT
AAATTTTATAAATTAAAATATAGTAATCACATCATGAACAGCTTATCTAAGTTCGCTCCA
AGCTATTCATTAGATCTTTGGCCAGTTCCTCAATAAATTCAAACTAAGATGAACATTGAA
AATGAAGAGTAATTTAAGGGAAAAATTTTCTAATAATCTTTCTTCTATTTGTTGGAAACT
AACCAATATTCATATGGAAGAGGATATGCTTTGGATGCCAGTGAGATTATATTCAATAAA
ATAGACGCTGAAAGACCTTAAGACTACTTGTCTAGAGCTAAATACATTCTCTTTAAATTA
ATTGAATTCCGTCAAAAGAGTATTAAATGGTCTATTGAAGAAATAAAACTAAGGACATTT
GATTCATGGATTAGACTATTTTGTTTAGTTACTTCTTCAGGAGTTGAAGGTTACGCTATG
AGTACTGTACAATCTTCTATTCCAAATTTCACTCTTAAGTAGCTCAGAGAGAGAAAGATT
ATTTTAGAGCATGAATAATTATGTTTACTCTATCCTAACTATGAAATAGAGTTTGTGAGT
GGATTTGTTAACATCTTCTGTGCCTGTAAATAAATAATTTTATATTTGCATTCAATTAAA
AACTTAATTTTATTTAAATAAAAATAGCTAACCCACAATGTGTTGGTCTTTTCTCTAACT
TATAGAGCGAAATGATGAAATAAATTCTCTAAGATTTGAAAAAAGGGTACTTTGGAGTGC
TCTTTGATCAAAAACTCAAATTTTTACTTTACATATTATTCTCACTCAGACACTTACAAG
ATCTAGACTACCATTCCAAAGAGTCAGAAAATAAAAAGACATAAAATCCTAATAATTTTA
TTGGTAGATCAAACTAAAATCAAGAAAGCTAACATTCTTTCTCAGATTCTTATAAAAAAG
AAGAAGCCGAAGATTTATTCAAAGTAATGACATAAATTTTAGAAGAAGCTGTCCATCGTG
GTACTAGAGTTCAAATATGTGATTTCATTTAGGTAAAATTAAAACGCTATTAAAATTAAT
ATAAATCAATTTATTTATTTATTTACTCTCTTATTTGCTTATTTTGTTTATTTACTTTTG
CTTTTTATAAAAGTGCTTATTCTTGCAATTACAAGTGATGGAAGTTCTCTACTTATAAAC
CTTCTAAAACAACAAGAAAAAATTCGTTATCAATGAAAACTTGAATCCTTACTTTACAAA
AATAATTGGTATTTTAATGAATTTGGCTGCTTAGAATATTGATGGTCTCCCTATTTTAAT
ATCTTGTCTTAACAGTGCCCTACATATCTATCCATAATACTTTATTCTTTAATTCAAATA
TCAAGTTAAAGCTTTAGAATTTTTGATTAATAAAATCTTTTATGAAAAGGTAATACTTAT
TATTTTCATTTATTATTTGTTTGATTAACTTTTTTAACTTTAAAATTAGAATGAAACTGC
TTAAATCTTTGTTTCTATTATAAATCTGTTGACAGATATTGCTAAGTATCCTGAAGGTGC
TCTTTTATTGAGTGAAGCTAATATTGTAAGTATGATATGCAACACTCCCATTTTTAAGAA
TATAGAAAATGAACCATTCTATTGGCAAAATGGAGAAAGAAATCTCTTACATTCTTTCTG
GTGTTGGAGTTTGAATTTCTATAAGGAATATATAATTTCATTGCCTTCAGATTTAGAAAA
CACAACTTCATCTTTCTAATTCTTATAGACTTATTTCACTCGTATTGCTAAAATTCTCTC
TATTCCTCAAGTTTTATAAAACACTGCTACAAATTTAGCTAATAACAAAATGATTAACAC
TGAATAAGAAAAGCTTTCTCTTGCAGTAAAAAAATTTTTGTTTTTAAATTTTATATTAAA
ATTAAATAATTTACTTATAAATTTATTACAGTATATGGAAGAAATCGAACTTATTTTGGA
ACTTCTCTCAGTTTATTTCTGCCAAGCCAATATCTTCAAAAGAAAGATGAGCAACGATTT
TGAATAAATACTTCAATTCTTGACTCATTGCACTATTTGCTTATTTAAGTAGGGTCTTTC
CATCCAATCTATCTTCATGCCAGTTTCTAAAATGGAAAAGAAGCTCTCTCAAATTTATGA
CATTTATCAGGTCAGCTCAGCAGACAGTGCTCACTTATATCACACATCTATACTTACTCC
TTCTCATACTCCAAACAAATAAGAGTTAGAAGCAGGCATCTCTACAGCTCACTCTGCTAT
TGGAGATACAGTAAATATCTAAATAGATTAATATTAAGATTATGAGATTAATTATTATTA
TTTAAATTAATAGAAAAATAAGAACTATAACTTATTCATCATTTAAGTTGAATTACACTA
CTAGAGCATTTTATTCAGTTTGTTTTCTTGTATCTAAGACGGTTTACAAGAATCAAGTTT
ACTTTAATTATTCTAATATTCTAGCAACAGCTTCAGTGATAATTTGATCAATAATGAAAG
CAAGTAAGTTTATTCTGTAAATTACTGGTAGAGCTTTGCAAATTCTTTGTTTGACTGCCT
TAAATTCGTAGAAAATACTCTAAATAAATGGGATTATAAGAAAAATAAAAATGTTAATAT
GGATGACTAGCTTGTCAAGCTTCGCGCTCTCACAAATTCTGTAGAGTATAACTTATGTTG
CTATGGATTTGGTTCTCAAACTTCTTTAATAAATAGTGCTAAAACAATTATTTAAACATC
TTAATTTAGTCTTTAAGCTATCGTTCTTTCTGCTATCAAGCACTTCTAAATGTTAAACGA
ATTCAAATAATGGTTTGGACACTCTATAAAAGACAGTTTAACTGATTTATAAAATAAATT
AAGTAATTTCTATTTATTTATTATTTTTCTTTTTATTTAATATTACCTAAAAATAGATGC
AAAGCTAGATGGATTGAAGAAACTAGAATATGAAGATATTTAACTTAAAAAATAAATTGA
AGAGCATATTTTACAATTCTAAAGGCTATCAGTGACATAAGATAGATATTGA