Identifiers and Description

Gene Model Identifier

TTHERM_00268040

Standard Name

NUP185

Aliases

PreTt09839 | 24.m00270 | 3690.m00084

Description

Viral A-type inclusion protein repeat containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF02524 ) KID repeat
  • ( PF01576 ) Myosin tail
  • ( PF00435 ) Spectrin repeat
  • ( PF02370 ) M protein repeat
  • ( PF00904 ) Involucrin repeat
  • ( PF01920 ) Prefoldin subunit
  • ( PF08647 ) BRE1 E3 ubiquitin ligase
  • ( PF04702 ) Vicilin N terminal region
  • ( TIGR02338 ) prefoldin, beta subunit
  • ( PF07926 ) TPR/MLP1/MLP2-like protein
  • ( TIGR00293 ) prefoldin, alpha subunit
  • ( PF08614 ) Autophagy protein 16 (ATG16)
  • ( PF00038 ) Intermediate filament protein
  • ( PF06810 ) phage minor structural protein GP20
  • ( PF08946 ) Osmosensory transporter coiled coil
  • ( PF06696 ) Streptococcal surface antigen repeat
  • ( TIGR02169 ) chromosome segregation protein SMC
  • ( PF04508 ) Viral A-type inclusion protein repeat
  • ( PF07197 ) Protein of unknown function (DUF1409)
  • ( PF06160 ) septation ring formation regulator EzrA
  • ( PF07200 ) Modifier of rudimentary (Mod(r)) protein
  • ( TIGR03398 ) phospholipase C accessory protein PlcR
  • ( TIGR01280 ) exodeoxyribonuclease VII, small subunit
  • ( PF06401 ) Alpha-2-macroglobulin RAP, C-terminal domain
  • ( PF05465 ) Halobacterial gas vesicle protein C
  • ( PF07334 ) Interferon-induced 35 kDa protein (IFP

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11%

TetraMine Data

TTHERM_00268040

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
WormBaseWBGene000225000.000000100009565553302locus:lfi-1 status:Partially
_confirmed UniProt:H2L0I3
protein_id:CCD73131.1
Tetrahymena borealisEI9_03526.10.00000030014504373857585hypothetical protein (1656 aa)
OxytrichaContig11784.0.g110.0000004998288985444982Reovirus sigma C capsid protei
n
SGDYDR356W0.000005000363240844623SPC110 Inner plaque spindle po
le body (SPB) component, ortho
log of human kendrin; involved
in connecting nuclear microtu
bules to SPB; interacts with T
ub4p-complex and calmodulin; p
hosphorylated by Mps1p in cell
cycle-dependent manner
DictyBaseDDB_G02905030.0002999184360822198DDB_G0290503 on chromosome: 5
position 4159418 to 4164037

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:28386019: Iwamoto M, Osakada H, Mori C, Fukuda Y, Nagao K, Obuse C, Hiraoka Y, Haraguchi T (2017) Compositionally distinct nuclear pore complexes of functionally distinct dimorphic nuclei in the ciliate Tetrahymena. Journal of cell science 130(10):1822-1834

Sequences

>TTHERM_00268040(coding)
ATGGATAGCAATTAAGCCGCAGACCAAGAAAAATAAGTTGAAGCATAGAATGAAGAATAA
AAATAAGAATAAGAAAACAATGAATAAAAGGAAAATGAATCTGAATAAGCTTAAACAGAT
CCATAAATCAGCTCAGGAAGTAATTAAAAATTTGATATTGAAATCACAGATGAAGACAAT
GACCCAGAGATTGAAAACAATCAAACTATAGAATAGATGAAATTTAAAGCTTATGACCTA
AAAGCTGAATTAAAAAAGGTAGGAAATTTAGCAGAAGAACTTAAAGTTAAATTCGCAAAT
TTGGAAACGGATTATGATTAATGTAAAGATGAAAAAGAAGAATTAGAAAAAAAGTATAAA
TAAAGTATTGAAAAGTATGGTGAAATGATGAAAAATTATGAACATTAGATTATTAGCTTA
GAAAACGAAAATAATATAAGAATTCAATAATTATAGCAGTAAATAGATGAATTAAAAAAA
TAGAATGAAGAAAAAGAATAGAGCTACTTAAATATGCAATAACAGATAAAATAAGATAAG
TAAAGCTTTGATGACATATAAAACAAATATGAAGAAATTAATAAACATAATTAAGAATAA
TTCAAATAAAATAGTGACCAATGGGTAAAACTAGTCAATCTAACTGAAGAAGTTATTTTC
AATTTTTACAATTCTAATTTCTTTACTGAAAATAAAGACGACATATCAAGTTAAACTCAT
ATAATATTGTAGCATCAATAAACTTTCCAACAATTAATTGAAAAATATGTGACCTTCTTA
GCTGAATAAAAAGAAAAAAATGAAGCTATTTCAGATGAAGCTTTTAACAAAATAAAATCT
GAAAACGGAAATGGTGTCTAAAAGACTAACCAAAGAGTATAAGATTTATAACAAAAGTTC
GAAGCGTACTAGCAATAATTCAATAAATTAAATTCAGAATCATAGGAAAATGAAACTAAA
CTCCAAGAAACAAAAAAGCAATTAGAAGATTTGTAAAATGAATTGGGAAACAAAAATAAT
TAAATATAAGAATTAAATGAATAGCATTAAAAATCTTAAACAGAAATCTAAAAATTGAAT
GAACAAATAACTTCAAATCAATAAAGAATAGAAGAGCTTTAGAAAAACGAAAATATCTTA
GTTGAGAAAGATAAAAATATAAATGAGATCAAAGAATAATTATCAGCTTTAAATCAGCAA
ATTGAAGGATTCAAGGATATTTAAAATAAGTTGGATACTAAAACTGAAGAATTTGAAAAG
CTTGAGAAAGATTTTAATTAATAAAAAAGTGAATTAGAAGAAAAAATAAAATCAAAAGAT
GAAGAAATAGAGAATCTCAGCAAAAAAATTCAAGATATAGTAGAATAATAACAAGAAAAA
CAAAAATAATTAGATGATTTGAATTCTAATTTATAAAATTCTAATAAAGAAAATGAATAA
CTGAAATAAGAAATTAATGATTTTAAAAATAAAATTAACAATAGTAACTAGGATTAAGAG
TAATAATCAAACTAATTAAAAGCAGAATTAAAACAAACTTAAGAATAGCTAAATGATTCT
TAATAAAAATTTGAATAAGCAGATAAAGAATTAAAAGATCTCAAATAGCAAATTGAAGAT
GAAAAAGTTAAATTGAATGATAAGAGTTAGGAATCAGAGAACTTGAAAGACTAACTCAAA
TCAGCAAATGAAAAACTAAATGAATCTCAATAAAAGTTAGAGCAAATTTAAAAAAATTTT
GATGATTTGAAGCAAAATAACGATTTACAGAAGATAGTTGATGAAAAACAATAAAAATGT
GAAGAATTAGAAAGAGAATTGAAAGAGTTAAAAACTTAACAAGAATAAGTTACAGCTTAA
GTCCAATAATTAAATGTAGAGAAAGAAGAAATTTAAACTAAATTTAACTAGGTCGAACAG
GAAAAAGAATAACTTAAAAAGTAAGAGCAAGAAAAAATTGACTTATTAAGTTAGGCTAAA
TAAGAAAAAGAAAATAATGAACAAGAAATCAATAATTTAAAGTAGACTATTGCAAATTTA
GAAAAAGAAAGAACAGATATTTAAATACAATCTTAAGAAAAAGATAAATAATTGGATGAC
GCTAAACATACCTTAGAAAATTTAAACAAAGAAATCGAACAATTAAAGAATTAAAATTAG
GCAATAGGTGATGTTAATGAGAAAAATAAGTAATTAGAAAGCGAAATCACCTAAATTAAA
AGCGAAATTGAATAAAAAAATACTGAAATTTAAAGTTTAAATAGTAAAAATGAAACTGAG
ATATCAGAAAAAAAATAATAACTTGAAGATCATACTAAATAAGTGAATTAGTTAAATGAA
TAAATTCATCAATTGAGCACTGAGAATGAAAACCTTAAAAACGAAATTCAAACTAACTAA
AATATATCTTAAACTAAATTAACAGATTTAAATTCTGAAATTGAAGGCTTTTAAAAAGAA
ATAGAAGAGACAAAACTATAGCTAGATGATAAAAATACATAGTTAAAAGGTTTACAGGTA
AAGCTAGAAGCACTTGAAAAGCAACTTTTAGAAAAAAATGAAGAAATACAAAAAGTAAAT
TAATAATTAAAAGAAAGTGAATAAAAGCACGAAGCCATCTAAAAATAGAATGAAGAATTG
TAAAATTCTTTGAAAACACTAGAGGAAAAAGATTATAATTAGATTCAAAACGATCTAAAT
TAGTAAGTTTCAGATTTAAAATAAAAAGAGTAGGATTTAAATAAATAATTAGATTAAAAG
TTGCAAGAAATCAATTAGATTAAATAATAATTATCAAATGAAACATCAGATTTCATGAAA
AAGAATGTATAACTTTAATAGACAATTTAGTAGCTAAATCAAACAATTTCATAATATCAA
GAACAAATAGAGAGAATAAAAACCGATTTATATTAAAGCTAATAAGAAAAAAGCTAACTT
TAAAGTAAATTAAATGAGGCAAACAGAGAAATTTAAAATAAAGAAGATGATTTAAATAAA
AAAGTAGAAATAATAGCTGAGCTTGAACAAAATAACAAAGATTTAAAAATAAATCTTCAC
AACTATGAAGTAAAGAGTTATGATTTAGATAAAGAGAGATTTGATGTGTTAGAAATATAG
ATATAACATAATAAAGAATAGTAAGTTTAGTATAAACAAGCAGAAGAAAAAATTTAAAAA
CTAGAAGAAGAAATAAAAAAGTTACTTGCTGACAAAACAGATTCATTGGAAAAACTCTAG
AAGGAAATTAAAACTGAATAAGTGATTGGAGAAGAGATGTCTAAGAAATTCAGATCAAAT
TTAGCAGAGTTATAAATCAATAACGAATAAAATAGCTTGGAAAATTCTCAAAAAACTATA
AATCAATTAGCAGAAGTAGTATTGAGAAAAGTAAAAGACTGTTTCTATTCCAGCACTAAA
ATTGTTTAAATTTCTCGTCTCTTTTATGATGGATCTGATGGACGTAATGCTTCACAAGAT
AATGCCCTTTCTTTAATCCAAGAACTTAATGAAGCCTAACACGCATCTATCACAATTCAC
AAGCTTTTAGGTTTCGAGTATAAGAAATTCAAGAATATTTTACCAATTTAATATTTAAGA
AACGACTTTAAGGTTATAAATCAAACAGAAAATACAACTTAGCCACTTTACGTTAATGAA
AATGATCAAGTTGCTTAATATGCAATAGTAAATTATGAAATCTAAAATAACAAATTTTAT
GTTGGATTGATTTAATTTGATGTTGTTAGCACTTACTTTAGAGTTGGTTTTGTCCCTGTT
AATCCTTAAACCAAATAAGAGTAGTGGGGTGAAGCTATTTATGCTAACTTCTGTCTAAAT
CATGAAGCTGCTAACTCAAAAAATTATAGAAATCTTGTGAGAATCAATCATTTCAATCCT
ATCTTTAGCATTAAAAAGGGCTATATCTATATTCGTTTTAATATCTAGAAGAACATTTTC
TAATTCTGTGACACAAATTATCAATTGAGCGAATTATCCAAATGCTAATTTAAAAGTGAT
TTACATTACAAACTCTTCATCGGCATGAAAGAAACTAAGGGACATTTCTAAATAGTTGAT
TTGAAGGAATAAAGTAGAGATGAAGATATTAATATTATGACTCAAATATTCTCTAATGAA
CAGCCATAATTCGAAGATTTGATTAGACTTTTTATTTGA


>TTHERM_00268040(protein)
MDSNQAADQEKQVEAQNEEQKQEQENNEQKENESEQAQTDPQISSGSNQKFDIEITDEDN
DPEIENNQTIEQMKFKAYDLKAELKKVGNLAEELKVKFANLETDYDQCKDEKEELEKKYK
QSIEKYGEMMKNYEHQIISLENENNIRIQQLQQQIDELKKQNEEKEQSYLNMQQQIKQDK
QSFDDIQNKYEEINKHNQEQFKQNSDQWVKLVNLTEEVIFNFYNSNFFTENKDDISSQTH
IILQHQQTFQQLIEKYVTFLAEQKEKNEAISDEAFNKIKSENGNGVQKTNQRVQDLQQKF
EAYQQQFNKLNSESQENETKLQETKKQLEDLQNELGNKNNQIQELNEQHQKSQTEIQKLN
EQITSNQQRIEELQKNENILVEKDKNINEIKEQLSALNQQIEGFKDIQNKLDTKTEEFEK
LEKDFNQQKSELEEKIKSKDEEIENLSKKIQDIVEQQQEKQKQLDDLNSNLQNSNKENEQ
LKQEINDFKNKINNSNQDQEQQSNQLKAELKQTQEQLNDSQQKFEQADKELKDLKQQIED
EKVKLNDKSQESENLKDQLKSANEKLNESQQKLEQIQKNFDDLKQNNDLQKIVDEKQQKC
EELERELKELKTQQEQVTAQVQQLNVEKEEIQTKFNQVEQEKEQLKKQEQEKIDLLSQAK
QEKENNEQEINNLKQTIANLEKERTDIQIQSQEKDKQLDDAKHTLENLNKEIEQLKNQNQ
AIGDVNEKNKQLESEITQIKSEIEQKNTEIQSLNSKNETEISEKKQQLEDHTKQVNQLNE
QIHQLSTENENLKNEIQTNQNISQTKLTDLNSEIEGFQKEIEETKLQLDDKNTQLKGLQV
KLEALEKQLLEKNEEIQKVNQQLKESEQKHEAIQKQNEELQNSLKTLEEKDYNQIQNDLN
QQVSDLKQKEQDLNKQLDQKLQEINQIKQQLSNETSDFMKKNVQLQQTIQQLNQTISQYQ
EQIERIKTDLYQSQQEKSQLQSKLNEANREIQNKEDDLNKKVEIIAELEQNNKDLKINLH
NYEVKSYDLDKERFDVLEIQIQHNKEQQVQYKQAEEKIQKLEEEIKKLLADKTDSLEKLQ
KEIKTEQVIGEEMSKKFRSNLAELQINNEQNSLENSQKTINQLAEVVLRKVKDCFYSSTK
IVQISRLFYDGSDGRNASQDNALSLIQELNEAQHASITIHKLLGFEYKKFKNILPIQYLR
NDFKVINQTENTTQPLYVNENDQVAQYAIVNYEIQNNKFYVGLIQFDVVSTYFRVGFVPV
NPQTKQEQWGEAIYANFCLNHEAANSKNYRNLVRINHFNPIFSIKKGYIYIRFNIQKNIF
QFCDTNYQLSELSKCQFKSDLHYKLFIGMKETKGHFQIVDLKEQSRDEDINIMTQIFSNE
QPQFEDLIRLFI


>TTHERM_00268040(gene)
ATGGATAGCAATTAAGCCGCAGACCAAGAAAAATAAGTTGAAGCATAGAATGAAGAATAA
AAATAAGAATAAGAAAACAGTAAATTTTTTTTTTTCAAATTCAATTTATAATTGTTAATG
TTTTTAAAAAGCCATTAATATATAATTATCTTAAAAATATTTCTAAATATTTTTTGAATC
CGGCTTCTATTTTTATTGAAACTTATGAACCAAATTAATATTCTGCTTACAATTGAAAAA
AACGAAATAAAGATTTTAGTTTAAAATAAATATTTTATTCAAGTAATAATTTTATTATTT
TATAATTAAGATGAATAAAAGGAAAATGAATCTGAATAAGCTTAAACAGATCCATAAATC
AGCTCAGGAAGTAATTAAAAATTTGATATTGAAATCACAGATGAAGACAATGACCCAGAG
ATTGAAAACAATCAAACTATAGGTAAAATTATTTTAAAAGTATACATAGTATATTAATAT
TGTTATTTTTATTTAAATTTAGAATAGATGAAATTTAAAGCTTATGACCTAAAAGCTGAA
TGTAAATATTGACTTTTAGCTTTTATATATAAACATTTTTTAGTAAAAAAGGTAGGAAAT
TTAGCAGAAGAACTTAAAGTTAAATTCGCAAATTTGGAAACGGATTATGATTAATGTAAA
GATGAAAAAGAAGAATTAGAAAAAAAGTATAAATAAAGTATTGAAAAGTATGGTGAAATG
ATGAAAAATTATGAACATTAGATTATTAGCTTAGAAAACGAAAATAATATAAGAATTCAA
TAATTATAGCAGTAAATAGATGAATTAAAAAAATAGAATGAAGAAAAAGAATAGAGCTAC
TTAAATATGCAATAACAGATAAAATAAGATAAGTAAAGCTTTGATGACATATAAAACAAA
TATGAAGAAATTAATAAACATAATTAAGAATAATTCAAATAAAATAGTGACCAATGGGTA
AAACTAGTCAATCTAACTGAAGAAGTTATTTTCAATTTTTACAATTCTAATTTCTTTACT
GAAAATAAAGACGACATATCAAGTTAAACTCATATAATATTGTAGCATCAATAAACTTTC
CAACAATTAATTGAAAAATATGTGACCTTCTTAGCTGAATAAAAAGAAAAAAATGAAGCT
ATTTCAGATGAAGCTTTTAACAAAATAAAATCTGAAAACGGAAATGGTGTCTAAAAGACT
AACCAAAGAGTATAAGATTTATAACAAAAGTTCGAAGCGTACTAGCAATAATTCAATAAA
TTAAATTCAGAATCATAGGAAAATGAAACTAAACTCCAAGAAACAAAAAAGCAATTAGAA
GATTTGTAAAATGAATTGGGAAACAAAAATAATTAAATATAAGAATTAAATGAATAGCAT
TAAAAATCTTAAACAGAAATCTAAAAATTGAATGAACAAATAACTTCAAATCAATAAAGA
ATAGAAGAGCTTTAGAAAAACGAAAATATCTTAGTTGAGAAAGATAAAAATATAAATGAG
ATCAAAGAATAATTATCAGCTTTAAATCAGCAAATTGAAGGATTCAAGGATATTTAAAAT
AAGTTGGATACTAAAACTGAAGAATTTGAAAAGCTTGAGAAAGATTTTAATTAATAAAAA
AGTGAATTAGAAGAAAAAATAAAATCAAAAGATGAAGAAATAGAGAATCTCAGCAAAAAA
ATTCAAGATATAGTAGAATAATAACAAGAAAAACAAAAATAATTAGATGATTTGAATTCT
AATTTATAAAATTCTAATAAAGAAAATGAATAACTGAAATAAGAAATTAATGATTTTAAA
AATAAAATTAACAATAGTAACTAGGATTAAGAGTAATAATCAAACTAATTAAAAGCAGAA
TTAAAACAAACTTAAGAATAGCTAAATGATTCTTAATAAAAATTTGAATAAGCAGATAAA
GAATTAAAAGATCTCAAATAGCAAATTGAAGATGAAAAAGTTAAATTGAATGATAAGAGT
TAGGAATCAGAGAACTTGAAAGACTAACTCAAATCAGCAAATGAAAAACTAAATGAATCT
CAATAAAAGTTAGAGCAAATTTAAAAAAATTTTGATGATTTGAAGCAAAATAACGATTTA
CAGAAGATAGTTGATGAAAAACAATAAAAATGTGAAGAATTAGAAAGAGAATTGAAAGAG
TTAAAAACTTAACAAGAATAAGTTACAGCTTAAGTCCAATAATTAAATGTAGAGAAAGAA
GAAATTTAAACTAAATTTAACTAGGTCGAACAGGAAAAAGAATAACTTAAAAAGTAAGAG
CAAGAAAAAATTGACTTATTAAGTTAGGCTAAATAAGAAAAAGAAAATAATGAACAAGAA
ATCAATAATTTAAAGTAGACTATTGCAAATTTAGAAAAAGAAAGAACAGATATTTAAATA
CAATCTTAAGAAAAAGATAAATAATTGGATGACGCTAAACATACCTTAGAAAATTTAAAC
AAAGAAATCGAACAATTAAAGAATTAAAATTAGGCAATAGGTGATGTTAATGAGAAAAAT
AAGTAATTAGAAAGCGAAATCACCTAAATTAAAAGCGAAATTGAATAAAAAAATACTGAA
ATTTAAAGTTTAAATAGTAAAAATGAAACTGAGATATCAGAAAAAAAATAATAACTTGAA
GATCATACTAAATAAGTGAATTAGTTAAATGAATAAATTCATCAATTGAGCACTGAGAAT
GAAAACCTTAAAAACGAAATTCAAACTAACTAAAATATATCTTAAACTAAATTAACAGAT
TTAAATTCTGAAATTGAAGGCTTTTAAAAAGAAATAGAAGAGACAAAACTATAGCTAGAT
GATAAAAATACATAGTTAAAAGGTTTACAGGTAAAGCTAGAAGCACTTGAAAAGCAACTT
TTAGAAAAAAATGAAGAAATACAAAAAGTAAATTAATAATTAAAAGAAAGTGAATAAAAG
CACGAAGCCATCTAAAAATAGAATGAAGAATTGTAAAATTCTTTGAAAACACTAGAGGAA
AAAGATTATAATTAGATTCAAAACGATCTAAATTAGTAAGTTTCAGATTTAAAATAAAAA
GAGTAGGATTTAAATAAATAATTAGATTAAAAGTTGCAAGAAATCAATTAGATTAAATAA
TAATTATCAAATGAAACATCAGATTTCATGAAAAAGAATGTATAACTTTAATAGACAATT
TAGTAGCTAAATCAAACAATTTCATAATATCAAGAACAAATAGAGAGAATAAAAACCGAT
TTATATTAAAGCTAATAAGAAAAAAGCTAACTTTAAAGTAAATTAAATGAGGCAAACAGA
GAAATTTAAAATAAAGAAGATGATTTAAATAAAAAAGTAGAAATAATAGCTGAGCTTGAA
CAAAATAACAAAGATTTAAAAATAAATCTTCACAACTATGAAGTAAAGAGTTATGATTTA
GATAAAGAGAGATTTGATGTGTTAGAAATATAGATATAACATAATAAAGAATAGTAAGTT
TAGTATAAACAAGCAGAAGAAAAAATTTAAAAACTAGAAGAAGAAATAAAAAAGTTACTT
GCTGACAAAACAGATTCATTGGAAAAACTCTAGAAGGAAATTAAAACTGAATAAGTGATT
GGAGAAGAGATGTCTAAGAAATTCAGATCAAATTTAGCAGAGTTATAAATCAATAACGAA
TAAAATAGCTTGGAAAATTCTCAAAAAACTATAAATCAATTAGCAGAAGTAGTATTGAGA
AAAGTAAAAGACTGTTTCTATTCCAGCACTAAAATTGTTTAAATTTCTCGTCTCTTTTAT
GATGGATCTGATGGACGTAATGCTTCACAAGATAATGCCCTTTCTTTAATCCAAGAACTT
AATGAAGCCTAACACGCATCTATCACAATTCACAAGCTTTTAGGTTTCGAGTATAAGAAA
TTCAAGAATATTTTACCAATTTAATATTTAAGAAACGACTTTAAGGTTATAAATCAAACA
GAAAATACAACTTAGCCACTTTACGTTAATGAAAATGATCAAGTTGCTTAATATGCAATA
GTAAATTATGAAATCTAAAATAACAAATTTTATGTTGGATTGATTTAATTTGATGTTGTT
AGCACTTACTTTAGAGTTGGTTTTGTCCCTGTTAATCCTTAAACCAAATAAGAGTAGTGG
GGTGAAGCTATTTATGCTAACTTCTGTCTAAATCATGAAGCTGCTAACTCAAAAAATTAT
AGAAATCTTGTGAGAATCAATCATTTCAATCCTATCTTTAGCATTAAAAAGGGCTATATC
TATATTCGTTTTAATATCTAGAAGAACATTTTCTAATTCTGTGACACAAATTATCAATTG
AGCGAATTATCCAAATGCTAATTTAAAAGTGATTTACATTACAAACTCTTCATCGGCATG
AAAGAAACTAAGGGACATTTCTAAATAGTTGATTTGAAGGAATAAAGTAGAGATGAAGAT
ATTAATATTATGACTCAAATATTCTCTAATGAACAGCCATAATTCGAAGATTTGATTAGA
CTTTTTATTTGA