Identifiers and Description

Gene Model Identifier

TTHERM_00760460

Standard Name

NUP155

Aliases

PreTt18531 | 125.m00095 | 3672.m00028 | Nup155

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00760460

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18985.19.997093137033517e-262hypothetical protein (2025 aa)
OxytrichaContig7662.0.g960.000000000029994712494008525Nup133 N terminal like
DictyBaseDDB_G02911630.0000000006000548789370351nup155 on chromosome: 5 positi
on 5077769 to 5082571
WormBaseWBGene000037940.0000020007268868677913locus:npp-8 status:Partially
_confirmed UniProt:Q95Y15
protein_id:CCD66719.2
SGDYBL079W0.00003998524687536623NUP170 Subunit of the nuclear
pore complex (NPC), required f
or NPC localization of specifi
c nucleoporins; involved in nu
clear envelope permeability an
d chromosome segregation; has
similar to Nup157p; essential
role, with Nup157p, in NPC ass
embly

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:28386019: Iwamoto M, Osakada H, Mori C, Fukuda Y, Nagao K, Obuse C, Hiraoka Y, Haraguchi T (2017) Compositionally distinct nuclear pore complexes of functionally distinct dimorphic nuclei in the ciliate Tetrahymena. Journal of cell science 130(10):1822-1834
  2. Ref:19375312: Iwamoto M, Mori C, Kojidani T, Bunai F, Hori T, Fukagawa T, Hiraoka Y, Haraguchi T (2009) Two distinct repeat sequences of Nup98 nucleoporins characterize dual nuclei in the binucleated ciliate tetrahymena. Current biology : CB 19(10):843-7

Sequences

>TTHERM_00760460(coding)
ATGAGCATTAACTTTTAATAGATTTCAACATCAAACTATCCAAATTTAAATTAAGAAAAA
ATGTCTTCTAAATTTTTATCCTCTGCTTAGAAGCGTAAGAGAGGGGATGATTATTTCTCT
CAGCAAGGTGGATTGTCTAATTTTAATGCATTTAATACAAATAAAGATAGGGATTAAAAG
TTCGCAGGTGATAGTTTTATAGGCAATTAACAATCTCAGTAAGCACAATTAGGCTATTTC
AATAAATTTGGGGACAATAAATCAACAAATTAAATGAATAACAATAATATTAGCATGATG
AGTAATCATGGATTTGTAATTTAGAATAACCTAAAAGGATATAATAGACATTCTTAGGAA
ACTTCTGCTAATACATTTTTAAATTAATCTTCTAATTAGCTTTATAAATTCAATGCAAAA
AATACAGAAATCAATTAGTTTAACTTTAATAACTAATTTAACTAAATATCTAACGAAACT
TTACCTATTCATTAGGATATTCCTCCTAACCCTCAAATATTAAATCCTGGTAGCTACAAT
ATTTCCTACAATAATGACACTGAATTGTTAAGACGTGAAGTTATCAAAGAATAGAATCTT
TAAGAAAAAATGCTTGTTGTGCAAAAAGAGCAAAAGATTTAATCTGAAATTGCTTACTCT
TTTAAATAAATGTCTCGTCTCTTGGATGCATGCTTGAAGTAGGATGAAACAGGAGCTGGT
ATAACTAGTGTAAAGTAAAATGATTTCTAACTCCCTCATGGAAGCAACTTTATCTAATTC
AAAGCCATTGAATTCCCATAAAGGATTGTAGAGTATTACACTGATTTGTTAGAAAATTAA
TATGAGTCTGATTAATAGCGTAATGATGAAGAATCTATTTCTGTTAATAAGGGAATTATT
GCAGAGTTAAGTTTGGCTTGGGTTAGCATAAATAAAAAATTATTTATGTGGAAATATGGT
CCTTAATCATTTGCATAGTTTACAAGACTTTACAATAAAAATGAATACTACAGACAAAAT
AAAGACTAATATGGCACAAAAAGAGATGATAAAATTGATAAGGATGACCTAAAGGAATTC
GATTTAGAGGACACAATACTTTATATAGCTTTTGGATAACCCAAATATGCAATTTTCAAA
TAAAATGAAATCAAAAATGTTCTTGTGATCGCATTCCCTAATTATATCAAAGTTATGCAT
ATCAAGCTAGAACATAACAACATAGATATTCAAGATATCAATGTTTCAATAAGTACTGAT
CATGAATACGTCAATAAAATTGTGTTCTCTAAGAAAGGAAGAATATTCTTTGGAGGATCA
AGTGGAAGAGTCAAATACATAGATTACTTTAAGTCTTAAATATTAGGAATTACAATAAGC
GAAAAATTCAAAGCTAAAGAAGGTGTGAATTGGTAATAAAAATTCAAACAATAAATTCCT
CTTTTGAATCAAGATCAATAAGTGATTGATATTAGTGTTGATGACACAAGATAGATTTTA
TATGCTTTGGTAGAAGTTTAGTGTGATAAACCTTTTTTTAGAAATCCGTTTTCATATAAC
CCTTACTAATAAAAAACAACTTAAAGAATTGATGTTTATGATTTAGGCGCTTTTGATGAA
GATTTTACTTTAATTGGTTCCTTAACTCATGCTCAATTTGCCGATTAACTCCTTTCTAGC
TAAACAAATCATTTCCATTTACTTCCTACAAGCAAAGAATTAAGTATTATATCAGTATCT
GCTATTGAAAAGTATCAATCAAACGATTATAATTTTGTTATTGTAACCTAATCTGGTATT
AGAGTCTACTATGTATTAAAAACTAAACCAGTAACTGACAAGAAAAACCAAATACTGAGT
GCTCAGGAAACAAAAGAAGCAAGAGAAAAATTCTAAATGTTTGAAAAATATAGACCGATT
GCAGAGTTTTAAATTGCTATTGTGAAGGGAATGTTAGATATTTCTCACTAGAACAGCGCA
TTCAGAAATCTTCATGTTTTTTATGATCACAAAGACTATCAAACTTGCAAAGGAAGCTAT
GTCTAAGTTATAGATGATGAACAGAAAAAATACATTAAATCTGCTTTTGCTACTCGTGGT
GGTGTCGTTATGTAGAAAATAGAAAATAAATAGAACAGGTTAATTTTCATCGAAAGTAAC
TAGTAGTATATTGCAAGGCTCAAGGAAAATATGTTTTCAAACCATCAAATATTTTCTGAA
ATACATCCCAATTTTGTAGTTGCAACAGAGCGCATGGGAGAATTAATTCTTGATTTCCAA
AACAGAGACGAGAACTCCAATATTCTTAATGATTTGACATTTGCTTAAATCCCTGAAAAA
AACTTACTTCCTCCTTAAATTAGTAGCCTAATTTTACTAAATAGCTTTGAATAGCTTGAA
ACAAGTTAGATGATTGGAGAATAAAATGGTCAATAAGCTTATGTTTGCTTGAATGATTTA
ACTAAATAATGTTATTCTTAGCCCTCCCATTATGTAGTACTGACTAGTAAGGGAATTTTA
TTGTATTACTAATAGAGACCTATTGATTTACTTTACCAACTTATTAAGGTACTTCCAGAT
TACATAACTGAGCCAAATTAGACTCAGGCTTAATTGTAATTTTAGCTATTAAACTAAAAG
AAACTAAACAAGTTCAGTAATAAGCAAATTGATATTAAAAACAATCAATAACAGAAATAA
AACTCATTAGAATTTTTTGAATAATTCATTATTACATATGGTGTAACTGAAACATTTGCT
ATGCTCTCATAAATGCTTTGCCACTCTCATTTAGAATACTATCAAAATTTAAATGTCCAT
AACCATCTTGACAAGTAACTTAAAAACAAGTTGTCAGATACTACACTCAACAACACAAAC
AACTTTACCTAGGGAACTTAATATGAGCAAAACACTAATAAATTCCCAGGATAAAAAAAT
AATGAAAAACCTCTTGACCCTTCTCAAATACCTGAAACAATAATCACAGAAATAAGCGAA
TCAATATTGAAAAAGTCTCATTTCTTGTTCTAAAAATATGGAGATATTTTGCTCGATGAG
ACCAGTGAAAATTAATATCAGTCTAAATAAATGAATGACGAATTCTAAAACACATTAGGT
AAAGCTTGGGAATGGACTAGAAGAAAATACACTTCCAAAGTAGAAGGTGTTTTATTATAC
TTCTCTAGATTAATTAGACCTGTTTGGAATAAACCTCTTGTCAATTCATATGCTTTTAAG
TTCTTCATTAATGAGCCTATTGAAAATTTCAAAAGAGAAGAAATTCAAGCTTTTACTCGT
CGTCTCAACGAGTTCAAGTTTTGGTTAGAAAACGAAACTAAAGTCATTTACTGCAACGAA
CTAAAAAACAACACTCTTCTTGGATCTGATTCTAACTAATCAATTAATAATATTTATATG
AAAAGTGCCTCTATTTCTACTTCTAATAGATATGGAAATTAAAATAGATATAAAAGCAAC
GAAGAAAGAATGTAAGAAATAAAAGCAGATGAGGCAAAATTAATTGATGATCTCCTTCGC
TTCTGCAGCAAAATAATTTAAGTTGCAAATCTCTTCCTTTTTATTTCTGAAAATAAATTA
AGGTCAAATCTGAACAACGTAGAATTTAGAGATTTAAGAGAAGAAATTCTATAAATCCGC
TTTAAAGATGTTTTTACTGACAAAAAGAATGAAAAAATTGTTAAAAACTATGTCTTATAA
GCAATTAAGCTTGACCCTAAATATATGGATTAGGCAAAGATGGTCTTGAGCTAATTTAAT
ACTATTTTCCATGATAGAGACTTCAATATTTCATAAGCTGAAATAAAGTTATAAATGATT
CTAAGTAAATTTGCAAGAACAGGAGTTCCTGAGGCAAAATATCTAAATGAGTGTACAAAT
ATCTTGTTGGAGCATATCGAATATCTCAATTCTGACTACATTGATAAATTCTTTATGATT
TATTCTTCTCTTGACTCCAGAGTAGATTTTACTAAAATTGCCATAGAATGCATTAAATTC
CATTAAAGAATCATAGAAAATATAGAGAGATAACAATAAGAGACCTAAGCTTTAGAAGAA
TAGTTGAGAGCTAGCTAATAATACAATCCTGTTAATAAGTATTCTGAATAGCTTAAAATT
TAAAAGTAAATTTTGGATGACAATTCTTAACAAAGAGAATTCTGCTTGCAAAAAATAATT
TAAATTCTTGAAGATTTACATAAGGAATCAGAGTTTGATCCAAAAACCAAAGTTAATAAG
GATCTATAAATACTTAATATAGTGAAACTCATTCAAAACTACCCATCAGATTTCGTTCAT
AGTGTTGTAATTGATTTCTTGTTGAGAAATAAAAGAAAGAGCGAAATTCTTGAACTAAAT
AGTCCTTTTACAGAATAAATATTTTCTAATTTTGGAACTGATAATGCAGAGTGTCTTAAA
ATCAAATTTAAGTACCTTGAACAAATGGGAAATGTAAGAGAGGCATACAATGTAGCGTTC
TAGTTATCAAATTTCAAGAATAGAGAAGAATCTGAGGATAGAGTTTTGCTTGATGATAGA
ATTTCATTTACAGAAATTGCTATTTATGACATTTCGGTTATTCTCAGCGATTTCAATATT
TCAGAGACTGACAAAATTAGATACTATGCTGAAAGAGAAATTCTTGTAAAGTAAGCAAGA
ATACTTAAAATTTAAAAGAAAATGTATGAGAAGCTCTTAAACGGAATAAATTATGTTGAA
AATAGTCTTAAAAAATCAAAAACTTCTGGTGATAAGAAAACACTTGAATAAAAAAAACTT
CTTTTGAAAGAAAGTTATGATGTATTACAATTCATGAGGCTTGACGAGCATATGTTAGAA
AAGTACTATGTATGGCCTTTAAATCTTGTAGAGTTTGCTCTTATATTATATGATATGACA
GGGGAATAAAAAGTTGACAGTTCAATAAATTCGATTTATGACAAGTTAATTGGTAGAATG
CTTGGCAACGATATTTACGAAACCAAACAATGGCCTCATAACATCTAAGATACACTAATT
ATGCTTAATGAAGAAATTGAAGAGAAAGCAAGATTGTTCAACTTAGATCATATTGTAGTA
AAATGCGAAAGCAACAATGCTTAAATTTCTCAAGACATCAAATTTTAGTTAAAGGATTTC
ATTTATTTATACAACTAACTACTTGTTTAGAAAGAGGATTCAGATATAAAGATTCTTTCA
TCTCCACTTTGGATGCCTCACTTTTTAGTCACTAAATTAAACTTTTCTCCTCTTAATTTG
ATTTCTCACTATAGCGCGATAGGAAATATATTAAAGGGAGAAGTTTCTAATAGTTATAAT
ATTCATATCAAGAACTGTCTTTTCATTCTCCTCAGACATTCAATAAATTACATTTCTAAT
GTCTTACAAAATCACGAATAACACTCTAGAGAGTTTATTTCCATTAGAAATTCCATATAA
ATATTGGAAAAAGTACTTGAGTCCTTCAATAACGAATTCATGGCACTTTTATAATCTTAG
ACTTAGAATAAATCTGAAATTATCTAATACTAATAACAATTAAGCAAATTGTAAGAAGAA
ATTTCTTTGTAAATCGGAGAAATTGAATAATTAGATAGTGATTTCTAATACTTAAATTAA
GGTGCTAATTATAATAATTCTATTGAAAGCTAGTAAAGTTTGCTTAATGGTAGCAAAAAT
AAAGAAGGTAATAGCCAAATCTTTGAGTTTGATCAAGATTCTAAGCCTTTGAAGGAAATG
CATAATGCTGAATATATTAGAAAAATGAAAGAGAAGCGTAACGATGCCTTACAAGATCCT
GCAAATAAACTATAAATGGCTTATATTTTAGGAGGTTTTACATCTTCTTTATAAAATAGA
AATGAAAGCAATGGAAGCAGCTTGAATCAAACAAACAAAAGTAAATAAAACACAAATTCT
AGCAATTAACATCAAACTATAAGTTTTGGAGACAGTAAATTCTTTGAATCGAATAGCAAT
AGTAGATAAAATAACACAAATTCATCAGGAATAAATGAATATGCATTTTACGAATTCAAT
AAAATCTTAGAAAATAAAAACGAACAAGAGATTTAATTAGAAAAGAACAAAAACTATTGA


>TTHERM_00760460(protein)
MSINFQQISTSNYPNLNQEKMSSKFLSSAQKRKRGDDYFSQQGGLSNFNAFNTNKDRDQK
FAGDSFIGNQQSQQAQLGYFNKFGDNKSTNQMNNNNISMMSNHGFVIQNNLKGYNRHSQE
TSANTFLNQSSNQLYKFNAKNTEINQFNFNNQFNQISNETLPIHQDIPPNPQILNPGSYN
ISYNNDTELLRREVIKEQNLQEKMLVVQKEQKIQSEIAYSFKQMSRLLDACLKQDETGAG
ITSVKQNDFQLPHGSNFIQFKAIEFPQRIVEYYTDLLENQYESDQQRNDEESISVNKGII
AELSLAWVSINKKLFMWKYGPQSFAQFTRLYNKNEYYRQNKDQYGTKRDDKIDKDDLKEF
DLEDTILYIAFGQPKYAIFKQNEIKNVLVIAFPNYIKVMHIKLEHNNIDIQDINVSISTD
HEYVNKIVFSKKGRIFFGGSSGRVKYIDYFKSQILGITISEKFKAKEGVNWQQKFKQQIP
LLNQDQQVIDISVDDTRQILYALVEVQCDKPFFRNPFSYNPYQQKTTQRIDVYDLGAFDE
DFTLIGSLTHAQFADQLLSSQTNHFHLLPTSKELSIISVSAIEKYQSNDYNFVIVTQSGI
RVYYVLKTKPVTDKKNQILSAQETKEAREKFQMFEKYRPIAEFQIAIVKGMLDISHQNSA
FRNLHVFYDHKDYQTCKGSYVQVIDDEQKKYIKSAFATRGGVVMQKIENKQNRLIFIESN
QQYIARLKENMFSNHQIFSEIHPNFVVATERMGELILDFQNRDENSNILNDLTFAQIPEK
NLLPPQISSLILLNSFEQLETSQMIGEQNGQQAYVCLNDLTKQCYSQPSHYVVLTSKGIL
LYYQQRPIDLLYQLIKVLPDYITEPNQTQAQLQFQLLNQKKLNKFSNKQIDIKNNQQQKQ
NSLEFFEQFIITYGVTETFAMLSQMLCHSHLEYYQNLNVHNHLDKQLKNKLSDTTLNNTN
NFTQGTQYEQNTNKFPGQKNNEKPLDPSQIPETIITEISESILKKSHFLFQKYGDILLDE
TSENQYQSKQMNDEFQNTLGKAWEWTRRKYTSKVEGVLLYFSRLIRPVWNKPLVNSYAFK
FFINEPIENFKREEIQAFTRRLNEFKFWLENETKVIYCNELKNNTLLGSDSNQSINNIYM
KSASISTSNRYGNQNRYKSNEERMQEIKADEAKLIDDLLRFCSKIIQVANLFLFISENKL
RSNLNNVEFRDLREEILQIRFKDVFTDKKNEKIVKNYVLQAIKLDPKYMDQAKMVLSQFN
TIFHDRDFNISQAEIKLQMILSKFARTGVPEAKYLNECTNILLEHIEYLNSDYIDKFFMI
YSSLDSRVDFTKIAIECIKFHQRIIENIERQQQETQALEEQLRASQQYNPVNKYSEQLKI
QKQILDDNSQQREFCLQKIIQILEDLHKESEFDPKTKVNKDLQILNIVKLIQNYPSDFVH
SVVIDFLLRNKRKSEILELNSPFTEQIFSNFGTDNAECLKIKFKYLEQMGNVREAYNVAF
QLSNFKNREESEDRVLLDDRISFTEIAIYDISVILSDFNISETDKIRYYAEREILVKQAR
ILKIQKKMYEKLLNGINYVENSLKKSKTSGDKKTLEQKKLLLKESYDVLQFMRLDEHMLE
KYYVWPLNLVEFALILYDMTGEQKVDSSINSIYDKLIGRMLGNDIYETKQWPHNIQDTLI
MLNEEIEEKARLFNLDHIVVKCESNNAQISQDIKFQLKDFIYLYNQLLVQKEDSDIKILS
SPLWMPHFLVTKLNFSPLNLISHYSAIGNILKGEVSNSYNIHIKNCLFILLRHSINYISN
VLQNHEQHSREFISIRNSIQILEKVLESFNNEFMALLQSQTQNKSEIIQYQQQLSKLQEE
ISLQIGEIEQLDSDFQYLNQGANYNNSIESQQSLLNGSKNKEGNSQIFEFDQDSKPLKEM
HNAEYIRKMKEKRNDALQDPANKLQMAYILGGFTSSLQNRNESNGSSLNQTNKSKQNTNS
SNQHQTISFGDSKFFESNSNSRQNNTNSSGINEYAFYEFNKILENKNEQEIQLEKNKNY


>TTHERM_00760460(gene)
ATGAGCATTAACTTTTAATAGATTTCAACATCAAACTATCCAAATTTAAATTAAGAAAAA
ATGTCTTCTAAATTTTTATCCTCTGCTTAGAAGCGTAAGAGAGGGGATGATTATTTCTCT
CAGCAAGGTGGATTGTCTAATTTTAATGCATTTAATACAAATAAAGATAGGGATTAAAAG
TTCGCAGGTGATAGTTTTATAGGCAATTAACAATCTCAGTAAGCACAATTAGGCTATTTC
AATAAATTTGGGGACAATAAATCAACAAATTAAATGAATAACAATAATATTAGCATGATG
AGTAATCATGGATTTGTAATTTAGAATAACCTAAAAGGATATAATAGACATTCTTAGGAA
ACTTCTGCTAATACATTTTTAAATTAATCTTCTAATTAGCTTTATAAATTCAATGCAAAA
AATACAGAAATCAATTAGTTTAACTTTAATAACTAATTTAACTAAATATCTAACGAAACT
TTACCTATTCATTAGGATATTCCTCCTAACCCTCAAATATTAAATCCTGGTAGCTACAAT
ATTTCCTACAATAATGACACTGAATTGTTAAGACGTGAAGTTATCAAAGAATAGAATCTT
TAAGAAAAAATGCTTGTTGTGCAAAAAGAGCAAAAGATTTAATCTGAAATTGCTTACTCT
TTTAAATAAATGTCTCGTCTCTTGGATGCATGCTTGAAGTAGGATGAAACAGGAGCTGGT
ATAACTAGTGTAAAGTAAAATGGTAATCATACTTACTTATTTATTTAAGCTTGTTGATCA
TTTATAAATATTTATAAAAGTAGTTTAAAATAAAGCAATAAAATAAGCATAAAAGCGGTA
AAAAATAATCAAATAAATTTGAAATTGTTGTGCTTGAAATATTTGAATTAAACCAAATTA
TTAGAATATTAGTTGCATTCATTTTAAATTCATTTCATTTTATTAAATCAAAAGATTTCT
AACTCCCTCATGGAAGCAACTTTATCTAATTCAAAGCCATTGAATTCCCATAAAGGATTG
TAGAGTATTACACTGATTTGTTAGAAAATTAATATGAGTCTGATTAATAGCGTAATGATG
AAGAATCTATTTCTGTTAATAAGGTAAAAGTTTTATTTAATTAAATAGCTTTATGTGTTA
GAACTTTCACTTAAAAGGAAAGCAAGGATATTAATAAAATAAAAGATAAAGTTTTCATAT
CATTAAATGTTAGCATTAAAGAAATTGATTATAGCTTATTTATATATGGATAATAAAATT
AAAATTTATATATAAAGGGAATTATTGCAGAGTTAAGTTTGGCTTGGGTTAGCATAAATA
AAAAATTATTTATGTGGAAATATGGTCCTTAATCATTTGCATAGTTTACAAGACTTTACA
ATAAAAATGAATACTACAGACAAAATAAAGACTAATATGGCACAAAAAGAGATGATAAAA
TTGATAAGGATGACCTAAAGGAATTCGATTTAGAGGACACAATACTTTATATAGCTTTTG
GATAACCCAAATATGCAATTTTCAAATAAAATGAAATCAAAAATGTTCTTGTGATCGCAT
TCCCTAATTATATCAAAGTTATGCATATCAAGCTAGAACATAACAACATAGATATTCAAG
ATATCAATGTTTCAATAAGTACTGATCATGAATACGTCAATAAAGTAATTAAATATTATA
TGGTTAAAAATCTTTGAAAAATAATTTATTTATTTTTTAATAGATTGTGTTCTCTAAGAA
AGGAAGAATATTCTTTGGAGGATCAAGTGGAAGAGTCAAATACATAGATTACTTTAAGTC
TTAAATATTAGGAATTACAATAAGCGAAAAATTCAAAGCTAAAGAAGGTGTGAATTGGTA
ATAAAAATTCAAACAATAAATTCCTCTTTTGAATCAAGATCAATAAGTGATTGATATTAG
TGTTGATGACACAAGATAGATTTTATATGCTTTGGTAGAAGTTTAGTGTGATAAACCTTT
TTTTAGAAATCCGTTTTCATATAACCCTTACTAATAAAAAACAACTTAAAGAATTGATGT
TTATGATTTAGGCGCTTTTGATGAAGATTTTACTTTAATTGGTTCCTTAACTCATGCTCA
ATTTGCCGATTAACTCCTTTCTAGCTAAACAAATCATTTCCATTTACTTCCTACAAGCAA
AGAATTAAGTATTATATCAGTATCTGCTATTGAAAAGTATCAATCAAACGATTATAATTT
TGTTATTGTAACCTAATCTGGTATTAGAGTCTACTATGTATTAAAAACTAAACCAGTAAA
AATAATTCAATTTATCGATTTAAAAATTAATAAATGTTAAATCAACATCTTAGGATGATG
GTTAAAAGAAAGAGAAAAAAAAATATTTGATCCTTCCTTAATTTATTTATTTATTTATTT
ATTTTTAAATATCTTTTTTTTAATTCAGGTAACTGACAAGAAAAACCAAATACTGAGTGC
TCAGGAAACAAAAGAAGCAAGAGAAAAATTCTAAATGTTTGAAAAATATAGACCGATTGC
AGAGTTTTAAATTGCTATTGTGAAGGGAATGTTAGATATTTCTCACTAGAACAGCGCATT
CAGAAATCTTCATGTTTTTTATGATCACAAAGTAAAAAAAATATATTTAGTGTAGTTAAT
TTTATATGGTTTTTATAAATCAGGACTATCAAACTTGCAAAGGAAGCTATGTCTAAGTTA
TAGATGATGAACAGAAAAAATACATTAAATCTGCTTTTGCTACTCGTGGTGGTGTCGTTA
TGTAGAAAATAGAAAATAAATAGAACAGGTTAATTTTCATCGAAAGTAACTAGTAGTATA
TTGCAAGGCTCAAGGAAAATATGTTTTCAAACCATCAAATATTTTCTGAAATACATCCCA
ATTTTGTAGTTGCAACAGAGCGCATGGGAGAATTAATTCTTGATTTCCAAAACAGAGACG
AGAACTCCAATATTCTTAATGATTTGACATTTGCTTAAATCCCTGAAAAAAACTTACTTC
CTCCTTAAATTAGTAGCCTAATTTTAGTAAAAAATTAAATTAAATTGAGAATATAAATAT
TTATTTACCAACATTAGTTTTTATTTTCAAATTAACTTATTTTAATTTATAATTTATTAG
CTAAATAGCTTTGAATAGCTTGAAACAAGTTAGATGATTGGAGAATAAAATGGTCAATAA
GCTTATGTTTGCTTGAATGATTTAACTAAATAATGTTATTCTTAGCCCTCCCATTATGTA
GTACTGACTAGTAAGGGAATTTTATTGTATTACTAATAGAGACCTATTGATTTACTTTAC
CAACTTATTAAGGTACTTCCAGATTACATAACTGAGCCAAATTAGACTCAGGCTTAATTG
TAATTTTAGCTATTAAACTAAAAGAAACTAAACAAGTTCAGTAATAAGCAAATTGATATT
AAAAACAATCAATAACAGAAATAAAACTCATTAGAATTTTTTGAATAATTCATTATTACA
TATGGTGTAACTGAAACATTTGCTATGCTCTCATAAATGCTTTGCCACTCTCATTTAGAA
TACTATGTAAAAAAAATTTTTTTGTAAATTCTTTATTTAAATTAATTCTTTTTATTAAGC
AAAATTTAAATGTCCATAACCATCTTGACAAGTAACTTAAAAACAAGTTGTCAGATACTA
CACTCAACAACACAAACAACTTTACCTAGGGAACTTAATATGAGCAAAACACTAATAAAT
TCCCAGGATAAAAAAATAATGAAAAACCTCTTGACCCTTCTCAAATACCTGAAACAATAA
TCACAGAAATAAGCGAATCAATATTGAAAAAGTCTCATTTCTTGTTCTAAAAAGTAAATT
TTAATTTTTATAAAAAATTGTATTTTTAATTTTGCTTCTTTTAAGTATGGAGATATTTTG
CTCGATGAGACCAGTGAAAATTAATATCAGTCTAAATAAATGAATGACGAATTCTAAAAC
ACATTAGGTAAAGCTTGGGAATGGACTAGAAGAAAATACACTTCCAAAGTAGAAGGTGTT
TTATTATACTTCTCTAGATTAATTAGACCTGTTTGGAATAAACCTCTTGTCAATTCATAT
GCTTTTAAGTTCTTCATTAATGAGCCTATTGAAAATTTCAAAAGAGAAGAAATTCAAGCT
TTTACTCGTCGTCTCAACGAGTTCAAGTTTTGGTTAGAAAACGAAACTAAAGTCATTTAC
TGCAACGAACTAAAAAACAACACTCTTCTTGGATCTGATTCTAACTAATCAATTAATAAT
ATTTATATGAAAAGTGCCTCTATTTCTACTTCTAATAGATATGTAAATTTATTTATGTTA
ATAGCCAATTTTTTGAAATTTATTTTAATAAATTAGGGAAATTAAAATAGATATAAAAGC
AACGAAGAAAGAATGTAAGAAATAAAAGCAGATGAGGCAAAATTAATTGATGATCTCCTT
CGCTTCTGCAGCAAAATAATTTAAGTTGCAAATCTCTTCCTTTTTATTTCTGAAAATAAA
TTAAGGTCAAATCTGAACAACGTAGAATTTAGAGATTTAAGAGAAGAAATTCTATAAATC
CGCTTTAAAGATGTTTTTACTGACAAAAAGAATGAAAAAATTGTTAAAAACTATGTCTTA
TAAGCAATTAAGCTTGACCCTAAATATATGGATTAGGTAAAATATTATTTACATTTAAAG
CTTATTAACACAGACTTTAAATAGGCAAAGATGGTCTTGAGCTAATTTAATACTATTTTC
CATGATAGAGACTTCAATATTTCATAAGCTGAAATAAAGTTATAAATGATTCTAAGTAAA
TTTGCAAGAACAGGAGTTCCTGAGGCAAAATATCTAAATGAGTGTACAAATATCTTGTTG
GAGCATATCGAATATCTCAATTCTGACTACATTGATAAATTCTTTATGATTTATTCTTCT
CTTGACTCCAGAGTAGATTTTACTAAAATTGCCATAGAATGCATTAAATTCCATTAAAGA
ATCATAGAAAATATAGGTAAATAAACAAATCAATTAAATGATAAAATAAATTTTTATTTT
TACTTCTAAATTAATAAAAGTTTAAAAGAAAATAAATTAATTAATAAAATATTTTTAATT
TAATTGGATCAAAATAATTCTCATAAAAAGCAAAATATAGTTTAATATTTGATTAATTAA
GCAATTATTGACTTTTATTTTAAAAAATGTTAATATTCTCTTTGAATTTAAATTTTAATA
TAAAGAGAGAAATTAAATTTTTGTTTGAAAAATAGTTTAAATATCTAAAGAATCTTTTGT
ATTAAATGTTATTTATTAAATTCTTCAATAAAATATTTAGAGAGATAACAATAAGAGACC
TAAGCTTTAGAAGAATAGTTGAGAGCTAGCTAATAATACAATCCTGTTAATAAGTATTCT
GAATAGCTTAAAATTTAAAAGTAAATTTTGGATGACAATTCTTAACAAAGAGAATTCTGC
TTGCAAAAAATAATTTAAATTCTTGAAGATTTACATAAGGAATCAGAGTTTGATCCAAAA
ACCAAAGTTAATAAGGATCTATAAATACTTAATATAGTGAAACTCATTCAAAACTACCCA
TCAGATTTCGTATGTTAATATTTTTTAAAATAAAATTAATTTTTATATTTTTTATTTAAA
CTAGGTTCATAGTGTTGTAATTGATTTCTTGTTGAGAAATAAAAGAAAGAGCGAAATTCT
TGAACTAAATAGTCCTTTTACAGAATAAATATTTTCTAATTTTGGAACTGATAATGCAGA
GTGTCTTAAAATCAAATTTAAGTACCTTGAACAAATGGGAAATGTAAGAGAGGCATACAA
TGTAGCGTTCTAGTTATCAAATTTCAAGAATAGAGAAGAATCTGAGGATAGAGTTTTGCT
TGATGATAGAATTTCATTTACAGAAATTGCTATTTATGACATTTCGGTTATTCTCAGCGA
TTTCAGTAAATAAAATTTTTTATGCTTTATAAAATATTAAAATTAACAAAAATAAAAAAG
ATATTTCAGAGACTGACAAAATTAGATACTATGCTGAAAGAGAAATTCTTGTAAAGTAAG
CAAGAATACTTAAAATTTAAAAGAAAATGTATGAGAAGCTCTTAAACGGAATAAATTATG
TTGAAAATAGTCTTAAAAAATCAAAAAGTAACTTTTATTTTTCTTAGTAATTAATTAAAA
ATATTAAAATAAATGTAAAGCTTCTGGTGATAAGAAAACACTTGAATAAAAAAAACTTCT
TTTGAAAGAAAGTTATGATGTATTACAATTCATGAGGCTTGACGAGCATATGTTAGAAAA
GTACTATGTATGGCCTTTAAATCTTGTAGAGTTTGCTCTTATATTATATGATATGACAGG
GGAATAAAAAGTTGACAGTTCAATAAATTCGATTTATGACAAGTTAATTGGTAGAATGCT
TGGCAACGATATTTACGAAACCAAACAATGGCCTCATAACATCTAAGATACAGTATATAA
ATTCGTTTTATTTAATTACAGCTAATTATTAGATTTATCAATTATTTTTAATTAATTTTC
ATTATTTTATTTTTAAAAGTTATTTAAATTTTTAAATAATTTTTTTTTGGTTTTTATATT
TTAAAAAATAAATTATTTGATAACAAATTAATTTTTAAATGCTTGTTAAATTTATTTAAA
TTGTTTTTTTTAATAAAATTATCTTGAATTTATTGATGTTGATTGATTATTTAATAAAAT
TTATTTTTAATTTTAGCTAATTATGCTTAATGAAGAAATTGAAGAGAAAGCAAGATTGTT
CAACTTAGATCATATTGTAGTAAAATGCGAAAGCAACAATGCTTAAATTTCTCAAGACAT
CAAATTTTAGTTAAAGGATTTCATTTATTTATACAACTAACTACTTGTTTAGAAAGAGGA
TTCAGATATAAAGATTCTTTCATCTCCACTTTGGATGCCTCACTTTTTAGTCACTAAATT
AAACTTTTCTCCTCTTAATTTGATTTCTCACTATAGCGCGATAGGAAATATATTAAAGGG
AGAAGTTTCTAATAGTTATAATATTCATATCAAGAACTGTCTTTTCATTCTCCTCAGACA
TTCAATAAATTACATTTCTAATGTCTTACAAAATCACGAATAACACTCTAGAGAGTTTAT
TTCCATTAGAAATTCCATATAAATATTGGAAAAAGTACTTGAGTCCTTCAATGTAATTAT
TATATATATTTATGAAAATTTTGTATAGTAAAAATATTATTTTTTTAAAACAGAACGAAT
TCATGGCACTTTTATAATCTTAGACTTAGAATAAATCTGAAATTATCTAATACTAATAAC
AATTAAGCAAATTGTAAGAAGAAATTTCTTTGTAAATCGGAGAAATTGAATAATTAGATA
GTGATTTCTAATACTTAAATTAAGGTGCTAATTATAATAATTCTATTGAAAGCTAGTAAA
GTTTGCTTAATGGTAGCAAAAATAAAGAAGGTAATAGCCAAATCTTTGAGTTTGATCAAG
ATTCTAAGCCTTTGAAGGAAATGCATAATGCTGAATATATTAGAAAAATGAAAGAGAAGC
GTAACGATGCCTTACAAGATCCTGCAAATAAACTATAAATGGCTTATATTTTAGGAGGTT
TTACATCTTCTTTATAAAATAGAAATGAAAGCAATGGAAGCAGCTTGAATCAAACAAACA
AAAGTAAATAAAACACAAATTCTAGCAATTAACATCAAACTATAAGTTTTGGAGACAGTA
AATTCTTTGAATCGAATAGCAATAGTAGATAAAATAACACAAATTCATCAGGAATAAATG
AATATGCATTTTACGAATTCAATAAAATCTTAGAAAATAAAAACGAACAAGAGATTTAAT
TAGAAAAGAACAAAAACTATTGA