Identifiers and Description

Gene Model Identifier

TTHERM_00455650

Standard Name

NUG1 (nuclear ribosome-associated GTPase NUG1)

Aliases

PreTt20294 | 53.m00196 | 3712.m00057

Description

nuclear ribosome-associated GTPase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( PF04548 ) AIG1 family
  • ( PF00350 ) Dynamin family
  • ( PF01926 ) GTPase of unknown function
  • ( PF08701 ) GNL3L/Grn1 putative GTPase
  • ( TIGR03156 ) GTP-binding protein HflX
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( PF00009 ) Elongation factor Tu GTP binding
  • ( TIGR00650 ) GTP-binding conserved hypothetical protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00455650

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13757.19.997093137033517e-262hypothetical protein (453 aa)
OxytrichaContig22056.0.g493.001222955304439e-10650S ribosome-binding GTPase
DictyBaseDDB_G02871477.00248144504223e-103gnl3 on chromosome: 4 position
5379967 to 5381914
WormBaseWBGene000038212.0008734984431652e-95locus:nst-1 Guanine nucleoti
de-binding protein-like 3 homo
log status:Confirmed UniPr
ot:Q21086 protein_id:CAA8886
0.1
SGDYER006W6.001629673589058e-65NUG1 GTPase that associates wi
th nuclear 60S pre-ribosomes,
required for export of 60S rib
osomal subunits from the nucle
us
Stentor CoeruleusSteCoe_63361.8521167695179754e-45

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00455650(coding)
ATGGGTAAACACGCTAATAAGCCTAAGCACGGAAACTCTAAGAGACAAACATGTGCTCAA
AAACATAAAATTGAAAAGAAAATTAAGGACCACAATAAAAAGATGAAAAAAGAAGCCAAG
AAGCTCAAGGCTTTGGGTATCATTAAGAAGAAGAGTACTCAAAATGTCGATCTTCCTAAC
TTGTTCCCTTACAAGAAGAATATTTTGGATCAATTAGAAAGAAAGAAAAAAGAAAAGGAA
TTAGAAAAGCTCTAAAACAAATAAAAAAATGAGGATATTGATATTGAAACTGTCCAAAAT
AAAGCTTTAATTTATGAAGAACAAGAGTTAAAGAACTTAGCAAAAGAAAACCAAAATGAA
TATGATGGAGTTCATCTTAATGAAGCTAATGTTATCGTAAAGGAAGGTAAAAAGTATTAC
AAGGAAATGAAAAAGGTTCTTGAAGCTTCTGATATCCTCCTCGAAGTATTAGATGCTAGA
GATCCCGAATCTTGCAGATGTAGAAAAGTTGAAGCTGAAGCTCTTTCTATGAAGGGTAAC
AAAAAGATCATTCTTGTCTTAAATAAGATCGACTTAGTTCCTGCAGGTAATGCTGAAGCA
TGGTTGAAAGTTCTCAGAAGAGAATATGCAACAGTCTTATTTAAGGGAAATACTTAAAAT
CAAAGCAGCAACTTATCTGGTAACAGTATCTTTAAAAAATCAATTACTGAAAGAGAAGAT
TTAACTAACGAATTGATGAGCAGTAGCAAGTCTGTTGGTGCTGATAAATTACTTGAATTG
ATTAAGAACTATTCCAAGAATGAAGGAACTAAAACTGCAGTTACTGTAGGTGTTATTGGT
TATCCCAATGTTGGAAAATCATCTCTTATTAACTCATTAAAAAGATCCAAAGCTTGTGGT
GTAAGCAGCACTGCTGGTTTCACAAAAACTTTATAAGAAGTTAGCATTGATAGCAAAGTT
AAAATTATTGATTGTCCCGGTGTAATCTTTGATGACGAAAGCAGCAAAAACTCTACCTTA
CTTAGAAATATAGTTAAGCCCGATTAAATTGAAGATCCTATAGTCCCTGTTGAAGAAATT
CTTAAAAAAGTAAGTAAAAACGATTTGCTTTTATTATACAAGATAGCTGATTTTAAAAAT
ACAACTGAATTCCTCTGCAATTTAGCATTAGCCAAGGGTAAAATAAAAAAGGGTGGTGCT
CCTAATTTAGATATGGCAGCAAGAATGGTTATTTAAGATTGGAATGCTGGTAAAATAAAA
TATTTCACAGTTCCTCCAGTTTATAATGATGTTGAAAGTTCTGCTATCAATAATAATAAT
CTTCAAAGCATTAATGAAATGGATCAAGAATGA


>TTHERM_00455650(protein)
MGKHANKPKHGNSKRQTCAQKHKIEKKIKDHNKKMKKEAKKLKALGIIKKKSTQNVDLPN
LFPYKKNILDQLERKKKEKELEKLQNKQKNEDIDIETVQNKALIYEEQELKNLAKENQNE
YDGVHLNEANVIVKEGKKYYKEMKKVLEASDILLEVLDARDPESCRCRKVEAEALSMKGN
KKIILVLNKIDLVPAGNAEAWLKVLRREYATVLFKGNTQNQSSNLSGNSIFKKSITERED
LTNELMSSSKSVGADKLLELIKNYSKNEGTKTAVTVGVIGYPNVGKSSLINSLKRSKACG
VSSTAGFTKTLQEVSIDSKVKIIDCPGVIFDDESSKNSTLLRNIVKPDQIEDPIVPVEEI
LKKVSKNDLLLLYKIADFKNTTEFLCNLALAKGKIKKGGAPNLDMAARMVIQDWNAGKIK
YFTVPPVYNDVESSAINNNNLQSINEMDQE


>TTHERM_00455650(gene)
ATGGGTAAACACGCTAATAAGCCTAAGCACGGAAACTCTAAGAGACAAACATGTGCTCAA
AAACATAAAATTGAAAAGAAAATTAAGGACCACAATAAAAAGATGAAAAAAGAAGCCAAG
AAGCTCAAGGCTTTGGGTATCATTAAGAAGAGTAAAAAATTTATTGATATATTATTAATT
AGCTCTTTATGGATGAAAATTTGTTAAAGATTTTCTTATCATGTTTATTATGAAGCAAAG
CTCATTCTTATGCAAATAAATCATCCAAATTTATTATTAGCATGATGATTTCCATACTTT
TCTTTATTTAAAGTTTCTTTAATTTAAATTTAGAGAGTACTCAAAATGTCGATCTTCCTA
ACTTGTTCCCTTACAAGAAGAATATTTTGGATCAATTAGAAAGAAAGAAAAAAGAAAAGG
AATTAGAAAAGCTCTAAAACAAATAAAAAAATGAGGATATTGATATTGAAACTGTCCAAA
ATAAAGCTTTAATTTATGAAGAACAAGAGTTAAAGAACTTAGCAAAAGAAAACCAAAATG
AATATGATGGAGTTCATCTTAATGAAGCTAATGTTATCGTAAAGGAAGGTAAAAAGTATT
ACAAGGAAATGAAAAAGGTTCTTGAAGCTTCTGATATCCTCCTCGAAGTATTAGATGCTA
GAGATCCCGAATCTTGCAGATGTAGAAAAGTTGAAGCTGAAGCTCTTTCTATGAAGGGTA
ACAAAAAGATCATTCTTGTCTTAAATAAGATCGACTTAGTTCCTGCGTAATAAATGAATA
AATTATTATAATCATAATTCTGAAACAATTTCAAATACTTTTGATAATATTTACTAAAAT
TAGCTTTTAGATTCCTTTATAAACATTTAAATTACTATTGTTAAAAACTAGTTTACTAAT
TTTTTGTTATTTAAAATAGAGGTAATGCTGAAGCATGGTTGAAAGTTCTCAGAAGAGAAT
ATGCAACAGTCTTATTTAAGGGAAATACTTAAAATCAAAGCAGCAACTTATCTGGTAACA
GTATCTTTAAAAAATCAATTACTGAAAGAGAAGATTTAACTAACGAATTGATGAGCAGTA
GCAAGTCTGTTGGTGCTGATAAATTACTTGAATTGATTAAGAACTATTCCAAGAATGAAG
GAACTAAAACTGCAGTTACTGTAGGTGTTATTGGTTATCCCAATGTTGGAAAATCATCTC
TTATTAACTCGTAAGATTAATTTAATTATAAGGTTAGCAAACTCAAGCAAATTTTTTGAA
AATAGATTAAAAAGATCCAAAGCTTGTGGTGTAAGCAGCACTGCTGGTTTCACAAAAACT
TTATAAGAAGTTAGCATTGATAGCAAAGTTAAAATTATTGATTGTCCCGGTGTAATCTTT
GATGACGAAAGCAGCAAAAACTCTACCTTACTTAGAAATATAGTTAAGCCCGATTAAATT
GAAGATCCTATAGTCCCTGTTGAAGAAATTCTTAAAAAAGTAAGTAAAAACGATTTGCTT
TTATTATACAAGATAGCTGATTTTAAAAATACAACTGAATTCCTCTGCAATTTAGCATTA
GCCAAGGGTAAAATAAAAAAGGTAAAGTTTATTTATTGTGAATCAAAATTTATATTAAAT
TATATAAATATTAAATATATAGGGTGGTGCTCCTAATTTAGATATGGCAGCAAGAATGGT
TATTTAAGATTGGAATGCTGGTAAAATAAAATATTTCACAGTTCCTCCAGTTTATGTAAT
TTATTTAATAGATTCAAAATTATTTATATTAAATTTATATTTATTAAATAAAAATAGAAT
GATGTTGAAAGTTCTGCTATCAATAATAATAATCTTCAAAGCATTAATGAAATGGATCAA
GAATGA