Identifiers and Description

Gene Model Identifier

TTHERM_00171760

Standard Name

NUD1 (NUDIX hydrolase 1)

Aliases

PreTt29785 | 14.m00352

Description

A component of the EZL1 complex (a Polycomb repressive complex)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00171760

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09963.19.997093137033517e-262hydrolase, NUDIX family protei
n (380 aa)
OxytrichaContig18549.0.g971.9993007828132465e-27NUDIX domain
DictyBaseDDB_G02855390.00000000000009996062864481225DDB_G0285539 on chromosome: 4
position 3354945 to 3356519
WormBaseWBGene000035800.0000009995106777214876locus:ndx-3 Nudix hydrolase
3 status:Confirmed UniProt
:Q23236 protein_id:CCD73693.
1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:33412588: Xu J, Zhao X, Mao F, Basrur V, Ueberheide B, Chait BT, Allis CD, Taverna SD, Gao S, Wang W, Liu Y (2021) A Polycomb repressive complex is required for RNAi-mediated heterochromatin formation and dynamic distribution of nuclear bodies. Nucleic acids research 49(10):5407-5425

Sequences

>TTHERM_00171760(coding)
ATGGATGCTAATAATAAAGGTAAAAAGTAAAATTAAACTAACTCTAAGCCTGAGGTAATT
AAACTAAAAGTTGGAGATGATCAACAGTTCCAAAAAATAGGAATTTGTCTTTTAGAAAAA
GTAAAGAATGAGCAATCAGAAAAATAGCTAGAGGAAGTGTAGGTTAATTTGTATTATGAT
CAAAAGTTAGGATATGCAAAATTGATAGATGCTTAAAAGTAGCAATAGGATAGACAAAAT
TTAGTTTACTAAAATATTATTTTGTAGCATGCAAATACTTGCCCTCATTTTCAATTTAGT
AGATTAGACTAACAATTCTAACTTAGTTAGTAGACTACTGGAGTAGCAGTTTGCGGAATC
ATAATTGATAAAAATAATTATGTCCTACTCACTAAAAGAAATCCTGAAATGAGAACATAT
CCTCGTTGTTGGGTATTTCCTGGAGGTTAAGTTGATTTAGGGGAAAGTTTTTTGAATACA
GTTTTTAGAGAAATTAAAGAAGAAGTTGGATTAAACATTCTTTTGCCTCAAAGTCAGTAA
GAGGAGAACTTTGACTTTGAAGAAGAATTCGAGCAGTAATCTCCAAAAAACTAATAAAAT
ACCATTGAAGAAAAAGAAGGAGGAATAGAAGAAGAACAAGAAAATATGTTTAAGAGATAA
ACTAGATTGTAGAAGAAAATTTAAGATTAGAAAAAGAAAGTAGAAACAAATCAATAAATG
AAAAAAGAAGATTTTTTAACAAAAAGTGCAGTGCACTTAATGGAAGACCCAAAACCTTTA
TTTTTATATGAAAGTGTATTCCCTACAGATATCAAAATAAACTACCCACAAAGATCAAGT
CTTGTCATATTTTACGCATTAAAAATTAAGGAATCTTTTAAGGATATTCAGCTATCTTAG
TAAAGAAAAGAAATTGATTATAGTGCTTGGATTCCTTTAGAATTGTTGAATAAATTGATT
GAAGAAAATGCAATAAGTGACAGTGAATTTTTATAGTAGTAGATAGAAACAGGAATATCT
ATTAATCATAATTACTTCCCCATCGGTCATAATTGTTTTGTAGGAAAATATCCTAACTAG
TTAGGAGAAGGTATTGGAGAAGCCCACATCAAAGCAATAAGAATGCTCAACCTCAAATAT
AATAAAAGCACTAAAGTCATCAAAATAAAATGA


>TTHERM_00171760(protein)
MDANNKGKKQNQTNSKPEVIKLKVGDDQQFQKIGICLLEKVKNEQSEKQLEEVQVNLYYD
QKLGYAKLIDAQKQQQDRQNLVYQNIILQHANTCPHFQFSRLDQQFQLSQQTTGVAVCGI
IIDKNNYVLLTKRNPEMRTYPRCWVFPGGQVDLGESFLNTVFREIKEEVGLNILLPQSQQ
EENFDFEEEFEQQSPKNQQNTIEEKEGGIEEEQENMFKRQTRLQKKIQDQKKKVETNQQM
KKEDFLTKSAVHLMEDPKPLFLYESVFPTDIKINYPQRSSLVIFYALKIKESFKDIQLSQ
QRKEIDYSAWIPLELLNKLIEENAISDSEFLQQQIETGISINHNYFPIGHNCFVGKYPNQ
LGEGIGEAHIKAIRMLNLKYNKSTKVIKIK


>TTHERM_00171760(gene)
ATGGATGCTAATAATAAAGGTAAAAAGTAAAATTAAACTAACTCTAAGCCTGAGGTAATT
AAACTAAAAGTTGGAGATGATCAACAGTTCCAAAAAATAGGAATTTGTCTTTTAGAAAAA
GTAAAGAATGAGCAATCAGAAAAATAGCTAGAGGAAGTGTAGGTTAATTTGTATTATGAT
CAAAAGTTAGGATATGCAAAATTGATAGATGCTTAAAAGTAGCAATAGGATAGACAAAAT
TTAGTTTACTAAAATATTATTTTGTAGCATGCAAATACTTGCCCTCATTTTCAATTTAGT
AGATTAGACTAACAATTCTAACTTAGTTAGTAGACTACTGGAGTAGCAGTTTGCGGAATC
ATAATTGATAAAAATAATTATGTCCTACTCACTAAAAGAAATCCTGAAATGAGAACATAT
CCTCGTTGTTGGGTATTTCCTGGAGGTTAAGTTGATTTAGGGGAAAGTTTTTTGAATACA
GTTTTTAGAGAAATTAAAGAAGAAGTTGGATTAAACATTCTTTTGCCTCAAAGTCAGTAA
GAGGAGAACTTTGACTTTGAAGAAGAATTCGAGCAGTAATCTCCAAAAAACTAATAAAAT
ACCATTGAAGAAAAAGAAGGAGGAATAGAAGAAGAACAAGAAAATATGTTTAAGAGATAA
ACTAGATTGTAGAAGAAAATTTAAGATTAGAAAAAGAAAGTAGAAACAAATCAATAAATG
AAAAAAGAAGATTTTTTAACAAAAAGTGCAGTGCACTTAATGGAAGACCCAAAACCTTTA
TTTTTATATGAAAGTGTATTCCCTACAGATATCAAAATAAACTACCCACAAAGATCAAGT
CTTGTCATATTTTACGCATTAAAAATTAAGGAATCTTTTAAGGATATTCAGCTATCTTAG
TAAAGAAAAGAAATTGATTATAGTGCTTGGATTCCTTTAGAATTGTTGAATAAATTGATT
GAAGAAAATGCAATAAGTGACAGTGAATTTTTATAGTAGTAGATAGAAACAGGAATATCT
ATTAATCATAATTACTTCCCCATCGGTCATAATTGTTTTGTAGGAAAATATCCTAACTAG
TTAGGAGAAGGTATTGGAGAAGCCCACATCAAAGCAATAAGAATGCTCAACCTCAAATAT
AATAAAAGCACTAAAGTCATCAAAATAAAATGA