Identifiers and Description

Gene Model Identifier

TTHERM_00155430

Standard Name

NTP9 (Nucleoside transporter 9)

Aliases

PreTt28333 | 13.m00292 | 3829.m01141

Description

Nucleoside transporter family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF01733 ) Nucleoside transporter
  • ( TIGR00939 ) Nucleoside Transporter
  • ( TIGR00997 ) intracellular septation protein A
  • ( PF07690 ) transporter, major facilitator family
  • ( PF06103 ) Bacterial protein of unknown function

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00155430

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05228.19.997093137033517e-262nucleoside transporter (503 aa
)
OxytrichaContig18964.0.g302.99851380290819e-19Nucleoside transporter
DictyBaseDDB_G02815130.000000030002053728821195DDB_G0281513 on chromosome: 3
position 4652073 to 4653629
SGDYAL022C0.000009999254677478949FUN26 Vacuolar membrane transp
orter with broad nucleoside se
lectivity; may regulate balanc
e of nicotinamide riboside (Nm
R) levels between cytosol and
vacuole, contributing to salva
ge of NmR for use in cytosolic
NAD+ synthesis

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00155430(coding)
ATGATATAATAGAACGCTTCCTTAAATATGTAACCTGATCAACATAATTATAGTCCTCCT
CTTTCATCTGTACTAAATTTAAAAGAAAATGAAGAAGATAAAAGATAAAACTTAAATGAT
ATTTCAATTAAATAAGATTCTTAACTAAATTCATTTTTATCTGCATAAAACGCTGAAGAG
ACTTAAAAAAAGATAGATGATATTTCAAAATAAATAGATTAAATGTATGAAGTACTTCCA
CCTGTTACTAATTTCTTTAAATTTTGTTTCATGATGTTTGGTATTTTAGCCTTTGCTGGA
TGGAATGCAGTAATTACTGCTTTTGATTATTTTTCTGTGCGTTACCCTAAAGAAACTATT
CCAGATGTTACATTTTATTTCCCTTTTGGAGTTATGGTGGGTGATTTATTAAGTGGAGTC
ACTTTTGTAGCTTAAGCAAAGTATTTTTCAGTGAAATCAAGATTTATGTATACTGTTACT
GTAGAAGTAATTGTTATTATTAGTCTTTGTATAGTTGCTATGTGCTATAATAATATTAAT
GGTTTTTGGATATCAATGGTTTTATTATTTATTGATGGCTGGGCTGATAATGTAAAAACA
AACACTTTTGTAGTTATTGCAGGGAGTGTTCATCCTTAATTAAATAATCTTTTTTGGACA
TACACTGCATTTTCTGGCTTAATAATGAATGCATTAAGATTTATTGTATTAGGGATATTT
GGAGATGATCTTGATAGCAATGCTAACTATGGTACTTTGCTTTATTTTATAGCCTGTGCT
ATAATATTTATAATTGCAATTATTTGTTTTGCCATTTTTATCAAGTCAAATTACTACAAA
ACTTCATTGTAAATTGATGCCCTAAAATAGCAAAAGATCTAATTAGAAAAAGAATTATAT
TTTATTAAAAACCAAACCGAGTAAATTAGCAGCACTATCTAACACAAAGGAATTTCTAAA
ATGTTTTGGGCTGCTATTAATTATTTAAAAGAGTTTATTTTTATAACTAAGCACACAGGA
TTCCTTTCATTATACCTTTTCATTTCTTTCTTTGAAACATTCTTGCTTTTTCCTGGAGTT
TGCGTTTTCAGAAAACCTGAATTCAAGTTCTTAGAATTTGCATGGGCTGCATAAGTTATG
ATGACAGCTTTTAACCTTGGAGATTTTATTGGGAAGTATATAGGTTATATTAAATAACTA
CATCGTCTCTATTGGATTTATGGGCTGGTAATTCTAAGAATTTCTTTTGTACCAATATTT
ATTTTGATGGCCTTAAATGAAGGAAGTTCAATCTTATAAAATGACTACTTTATTATGTGT
ATGATATTCCTTTTTTCTATAACTAATGGGTTTATTACTACAAGCTTAACTCATTTATCT
CCAAGAAAAATAACTGATCCTTATATTAGGGATAAAGTTAACTTTTTTAGTAATTTTACT
ATGACCTTAGGTATTGATCTTGGCATAGTCTTAGCTATTTTCTTAAGTAACGCTCTGCCA
AACTACAGTTGA


>TTHERM_00155430(protein)
MIQQNASLNMQPDQHNYSPPLSSVLNLKENEEDKRQNLNDISIKQDSQLNSFLSAQNAEE
TQKKIDDISKQIDQMYEVLPPVTNFFKFCFMMFGILAFAGWNAVITAFDYFSVRYPKETI
PDVTFYFPFGVMVGDLLSGVTFVAQAKYFSVKSRFMYTVTVEVIVIISLCIVAMCYNNIN
GFWISMVLLFIDGWADNVKTNTFVVIAGSVHPQLNNLFWTYTAFSGLIMNALRFIVLGIF
GDDLDSNANYGTLLYFIACAIIFIIAIICFAIFIKSNYYKTSLQIDALKQQKIQLEKELY
FIKNQTEQISSTIQHKGISKMFWAAINYLKEFIFITKHTGFLSLYLFISFFETFLLFPGV
CVFRKPEFKFLEFAWAAQVMMTAFNLGDFIGKYIGYIKQLHRLYWIYGLVILRISFVPIF
ILMALNEGSSILQNDYFIMCMIFLFSITNGFITTSLTHLSPRKITDPYIRDKVNFFSNFT
MTLGIDLGIVLAIFLSNALPNYS


>TTHERM_00155430(gene)
AAATAATTAATTAAGAATATTAAGTCTAAGGATTTACACTTCGCATTTTTAGAATAAGCT
TATAATTTTCAATTAATATCCAAATACAAGCAAAATAGCCAAAAGGCCAAATTAAATTCT
ACAAGAAATTGTATCTTTTTCAGAAATTGAAATCTGAAATATTGTATGATATAATAGAAC
GCTTCCTTAAATATGTAACCTGATCAACATAATTATAGTCCTCCTCTTTCATCTGTACTA
AATTTAAAAGAAAATGAAGAAGATAAAAGATAAAACTTAAATGATATTTCAATTAAATAA
GATTCTTAACTAAATTCATTTTTATCTGCATAAAACGCTGAAGAGACTTAAAAAAAGATA
GATGATATTTCAAAATAAATAGATTAAATGTATGAAGTACTTCCACCTGTTACTAATTTC
TTTAAATTTTGTTTCATGATGTTTGGTATTTTAGCCTTTGCTGGATGGAATGCAGTAATT
ACTGCTTTTGATTATTTTTCTGTGCGTTACCCTAAAGAAACTATTCCAGATGTTACATTT
TATTTCCCTTTTGGAGTTATGGTGGGTGATTTATTAAGTGGAGTCACTTTTGTAGCTTAA
GCAAAGTATTTTTCAGTGAAATCAAGATTTATGTATACTGTTACTGTAGAAGTAATTGTT
ATTATTAGTCTTTGTATAGTTGCTATGTGCTATAATAATATTAATGGTTTTTGGATATCA
ATGGTTTTATTATTTATTGATGGCTGGGCTGATAATGTAAAAACAAACACTTTTGTAGTT
ATTGCAGGGAGTGTTCATCCTTAATTAAATAATCTTTTTTGGACATACACTGCATTTTCT
GGCTTAATAATGAATGCATTAAGATTTATTGTATTAGGGATATTTGGAGATGATCTTGAT
AGCAATGCTAACTATGGTACTTTGCTTTATTTTATAGCCTGTGCTATAATATTTATAATT
GCAATTATTTGTTTTGCCATTTTTATCAAGTCAAATTACTACAAAACTTCATTGTAAATT
GATGCCCTAAAATAGCAAAAGATCTAATTAGAAAAAGAATTATATTTTATTAAAAACCAA
ACCGAGTAAATTAGCAGCACTATCTAACACAAAGGAATTTCTAAAATGTTTTGGGCTGCT
ATTAATTATTTAAAAGAGTTTATTTTTATAACTAAGCACACAGGATTCCTTTCATTATAC
CTTTTCATTTCTTTCTTTGAAACATTCTTGCTTTTTCCTGGAGTTTGCGTTTTCAGAAAA
CCTGAATTCAAGTTCTTAGAATTTGCATGGGCTGCGTAAAATTTAATTTCTTTTTTATGT
TAGATCTAAATTGTATTAAAACAATTTTTTACAAATTAAAATATAATCAAAATACTGCAT
CTAAACAAAGCAGTAAAAGCAATAATCAAATTAATAAAAAAATATGATTTTGGATTGTTA
TATCTAATAAACTTTTTTTAAAAATGAGATAAAATAGAATTTAAATAACAAAAATAAAAA
ATAATTTACAAGAAAATTGTATTTTAATGAAATTGTTTATTTAAATTATAAAAAATACAT
ATTTTAAGTTATTGAAAAAATAGATTATTTAAATAATAATAATATTAATTTTATTAATAG
ATAAGTTATGATGACAGCTTTTAACCTTGGAGATTTTATTGGGAAGTATATAGGTTATAT
TAAATAACTACATCGTCTCTATTGGATTTATGGGCTGGTAATTCTAAGAATTTCTTTTGT
ACCAATATTTATTTTGATGGCCTTAAATGAAGGAAGTTCAATCTTATAAAATGACTACTT
TATTATGTGTATGATATTCCTTTTTTCTATAACTAATGGGTTTATTACTACAAGCTTAAC
TCATTTATCTCCAAGAAAAATAACTGATCCTTATATTAGGGATAAAGTTAACTTTTTTAG
TAATTTTACTATGACCTTAGGTATTGATCTTGGCATAGTCTTAGCTATTTTCTTAAGTAA
CGCTCTGCCAAACTACAGTTGA