Identifiers and Description

Gene Model Identifier

TTHERM_00561500

Standard Name

NTP7 (Nucleoside transporter 7)

Aliases

PreTt27911 | 74.m00188 | 3720.m00078

Description

Nucleoside transporter family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF01733 ) Nucleoside transporter
  • ( TIGR00939 ) Nucleoside Transporter
  • ( PF01970 ) Integral membrane protein
  • ( PF08311 ) Mad3/BUB1 homology region 1
  • ( PF07690 ) transporter, major facilitator family
  • ( PF03595 ) C4-dicarboxylate transporter/malic acid transport protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.1%

TetraMine Data

TTHERM_00561500

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16133.19.997093137033517e-262nucleoside transporter (429 aa
)
OxytrichaContig18964.0.g303.9983110956465888e-22Nucleoside transporter
DictyBaseDDB_G02815130.000019995566179747357DDB_G0281513 on chromosome: 3
position 4652073 to 4653629
WormBaseWBGene000094990.0009001042212099794locus:ent-7 status:Confirmed
UniProt:F5GUE6 protein_id
:CCA65563.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00561500(coding)
ATGAATGACATTTTACTATTAATAGACTAAAAAAATGATCCTAATTTTTTAGAAAAATTG
AACTACGCCTTTTTAGGTGTTAGTGGTGTATTGGGTTGGAATGCTGTTCTTACTTCTCTT
CAATACTTTGATGATTAGTTTGAAAATTATGATATTAGCTTTTTACTCCCAATCCCTTAA
TTGTTTGCAAATTTCTTTTTTGGAGCTATTCTACCTTAATTGAGAAAGTATATCCATGTA
AAGGTTTGTGTTATTGGGTCTATGATTGGAATGATTATTTGTTTAGCAACTTTGCCCGTG
ATAACTTACTTTATGAGCCAAACTCTGATGGGTTTTATTTTTGTTTTGACACTGTCTTTC
TTTTTAGGTATGTTTAATGCAGTACTATAGGGCGCTGTAGTTAGCATAACGAATGTTGTT
CATCATAAATTGGCAGCTATTTACTGGACATATAATGGGTTTTCTGGTTTACTTATGAAT
CTTTTTTATGCAATTTCGTTATTGATTTTTCCTTCAAGTCTTCAAACAGGTGCTATTTTT
TACTATTCAATTTCTGCACTGTTTATATCTACTGCAGCATTTTTCTTTAATAAATACTAC
AACAAAAAATATAACATCGGAGATGATTAACAAGAGCACTAATTGCTTGATGATGACTTA
TATGAAAAATCGTCAACAAAAAGCTAATCTTCTTATAACCAGGGAGGAAAATCTGAGTAT
TTTAGTCTCATATGGAGAGCATTTAAGGCAGGTTTCCCAATTCCATTGCTAATTTGGCTT
CATTTTGTTTAACTTTAAACAGTGTTTCCAGGTTTAGCTGTGTTTAAGGTAGATTTAGGA
TGGTCTTCAAACACTTGGAATTCTCTTTTCTTAATAACTTTTGCAAATGTAGGAGACACA
ATAGGAAAATATGCTGCAGGAATAATTAAAAAGTATTACAATTTAAAGATCATAATAGCT
TTGATCATGTCTAGATTCCTCTTAATTGCTTTTTTTATTTTGAGTGCATACTATACTTAT
GAAGATGAATAGATATTCTTTAGATAATCGTATTTTATAGTTTTAAACATAATTATTTTT
TCTTTTCTGACTGGCTTTTGCACTTCTGCTTTGATGTAGTTATCTCCTTCCCTCTTAAAA
GAAGATGAGTTAGTTCTAAAAGAATAACTAGGATTTGTAAATGTAGTTATGCTCACTTTT
GGAATTTCTTGTGGTACTTTTACTGCCCTTTCCTTTACAAACTTTGGAAAGACAAATTGA


>TTHERM_00561500(protein)
MNDILLLIDQKNDPNFLEKLNYAFLGVSGVLGWNAVLTSLQYFDDQFENYDISFLLPIPQ
LFANFFFGAILPQLRKYIHVKVCVIGSMIGMIICLATLPVITYFMSQTLMGFIFVLTLSF
FLGMFNAVLQGAVVSITNVVHHKLAAIYWTYNGFSGLLMNLFYAISLLIFPSSLQTGAIF
YYSISALFISTAAFFFNKYYNKKYNIGDDQQEHQLLDDDLYEKSSTKSQSSYNQGGKSEY
FSLIWRAFKAGFPIPLLIWLHFVQLQTVFPGLAVFKVDLGWSSNTWNSLFLITFANVGDT
IGKYAAGIIKKYYNLKIIIALIMSRFLLIAFFILSAYYTYEDEQIFFRQSYFIVLNIIIF
SFLTGFCTSALMQLSPSLLKEDELVLKEQLGFVNVVMLTFGISCGTFTALSFTNFGKTN


>TTHERM_00561500(gene)
ATGAATGACATTTTACTATTAATAGACTAAAAAAATGATCCTAATTTTTTAGAAAAATTG
AACTACGCCTTTTTAGGTGTTAGTGGTGTATTGGGTTGGAATGCTGTTCTTACTTCTCTT
CAATACTTTGATGATTAGTTTGAAAATTATGATATTAGCTTTTTACTCCCAATCCCTTAA
TTGTTTGCAAATTTCTTTTTTGGAGCTATTCTACCTTAATTGAGAAAGTATATCCATGTA
AAGGTTTGTGTTATTGGGTCTATGATTGGAATGATTATTTGTTTAGCAACTTTGCCCGTG
ATAACTTACTTTATGAGCCAAACTCTGATGGGTTTTATTTTTGTTTTGACACTGTCTTTC
TTTTTAGGTATGTTTAATGCAGTACTATAGGGCGCTGTAGTTAGCATAACGAATGTTGTT
CATCATAAATTGGCAGCTATTTACTGGACATATAATGGGTTTTCTGGTTTACTTATGAAT
CTTTTTTATGCAATTTCGTTATTGATTTTTCCTTCAAGTCTTCAAACAGGTGCTATTTTT
TACTATTCAATTTCTGCACTGTTTATATCTACTGCAGCATTTTTCTTTAATAAATACTAC
AACAAAAAATATAACATCGGAGATGATTAACAAGAGCACTAATTGCTTGATGATGACTTA
TATGAAAAATCGTAATTAATTTATTTAATTTCAATAATTTTTAGCTTTTAAAATATTCTC
TTCTAATTTAGAAGTATAAATTTATTCTTAAACATTTAATGCTTTAAAAAGTTTGTATGG
ACAATTTTACACTTATTTTTTTTTTTGAAAGTTTGATAAATTCTATTTAGAATTTGAGGT
CAAAATTAAATATAATTGTTAGTAATTCATTTAGGAGACATTAATATATAAAAAAGGTCA
ACAAAAAGCTAATCTTCTTATAACCAGGGAGGAAAATCTGAGTATTTTAGTCTCATATGG
AGAGCATTTAAGGCAGGTTTCCCAATTCCATTGCTAATTTGGCTTCATTTTGTTTAACTT
TAAACAGTGTTTCCAGGTTTAGCTGTGTTTAAGGTAGATTTAGGATGGTCTTCAAACACT
TGGAATTCTCTTTTCTTAATAACTTTTGCAAATGTAGGAGACACAATAGGAAAATATGCT
GCAGGAATAATTAAAAAGTATTACAATTTAAAGATCATAATAGCTTTGATCATGTCTAGA
TTCCTCTTAATTGCTTTTTTTATTTTGAGTGCATACTATACTTATGAAGATGAATAGATA
TTCTTTAGATAATCGTATTTTATAGTTTTAAACATAATTATTTTTTCTTTTCTGACTGGC
TTTTGCACTTCTGCTTTGATGTAGTTATCTCCTTCCCTCTTAAAAGAAGATGAGTTAGTT
CTAAAAGAATAACTAGGATTTGTAAATGTAGTTATGCTCACTTTTGGAATTTCTTGTGGT
ACTTTTACTGCCCTTTCCTTTACAAACTTTGGAAAGACAAATTGA