Identifiers and Description

Gene Model Identifier

TTHERM_00221150

Standard Name

NTP6 (Nucleoside transporter 6)

Aliases

PreTt22443 | 18.m00469 | 3701.m00226

Description

Nucleoside transporter family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF01733 ) Nucleoside transporter
  • ( PF03825 ) Nucleoside H+ symporter
  • ( TIGR00939 ) Nucleoside Transporter
  • ( PF07690 ) transporter, major facilitator family
  • ( PF00083 ) transporter, major facilitator superfamily
  • ( PF02366 ) dolichyl-phosphate-mannose-protein mannosyltransferase
  • ( PF01032 ) iron chelate uptake ABC transporter,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00221150

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06796.19.997093137033517e-262nucleoside transporter (420 aa
)
OxytrichaContig18964.0.g309.9981864321491e-40Nucleoside transporter
DictyBaseDDB_G02834391.0002869940498747e-21DDB_G0283439 on chromosome: 4
position 699253 to 700845
Stentor CoeruleusSteCoe_136450.0000000000006914400106940203
WormBaseWBGene000105100.0000009995106777214876locus:ent-3 status:Partially
_confirmed UniProt:Q21145
protein_id:CAB01223.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00221150(coding)
ATGTCTAGTGAACACCCTATCACTTTATAGCATAAGATCACATTCATTTTGTTGGGAATT
GCTTCTCTTATAGGATGGAATGCTATTTTGACTGCTTTAAGTTTCTTCTCAACATATTAT
CCTAAAGATGAATACGGCGGTGATGTATCTTTCTTATTCCCTATCCCTCTCTTTTTTGGT
AATTTTATTTGGGGTTTACTAGTTCCTAAGCTTGGTGAATTCATTTCTCTTACTAAGCGT
ATCTCTTTATGTTTAGCTGCTATCTGTGTATTTATGATCTGCTTACCTTTAATTACAATT
GGTCTCTAAAACAAGGCTGGCTTCGCACTTTGTTTGATCTGTACATTTATTATTGGTAGC
TTCAATAGTATTGCACAAAACTCTTGCATTGGTTTGGCTAGTTAAGTTGATGGTAGTTTG
ACTGGTTTATATTGGGTTTCTACTGGTATTAGTGGTTTAACTATGAATGCTGCTAATGCA
ATTACTTTAGCTTCTTTTGGTGATTCAGATGATGGTTTAAAAATTGGAACAATTATTTAT
TTTGCTATTGCTGTCATCATCACTCTTTTAGCAATATGGTCATAAATAGCATTTGTAAAA
AGCGATTATTACTTGGACATCAAAAAGTAACATGAAGAGTCTGGATAAGATAATGAAGAG
GACAATACAGTTTCTGCTATATCAGGAGAAGAAGAAACTCCTCTTGTTGGAAAAAAGAAA
TCAATTGGAGAATAGCTCAAGGCATATGGCAACAAGATCCTCAGTGGTATTAAGCTTGCT
CGTTTTGTACCCTTTTTCATATACTTGATTTATGTTTAAACCTTCATGCTTTTCCCTGGT
GTGTCTGTTTTTAGCAAACCTTCCTATACCTACCTTCCTGGCAGTTGGCCTACTCTAGTT
ATGTTAACAACTTACAATGTTGGTGATATTATCGGAAAATACATTTGCAACTTCAAATTT
TATAACATCCCTATTTTATATGGTGTTGTTATATCTAGATTTGTTTTCTTTGTCACATTT
TTAATGACTATGCACTAACCTGACAATTCTTTCTTTAGTAATGATGCTTTTGCTTACGTT
AATATGCTTTTATTTGCTATAACTAATGGTTTTTGTACAGGAGGTTTAATGTTCTTAGGA
CCTACCAGAGGTAACAATAAGAAATAAGCTGAATTGATTGCTTTCATTAACTCTTTCAGC
TTGACTTTTGGTATAGCATGTGGATCTTTCCTAGCTCCAACTCTTTCTGGTTGA


>TTHERM_00221150(protein)
MSSEHPITLQHKITFILLGIASLIGWNAILTALSFFSTYYPKDEYGGDVSFLFPIPLFFG
NFIWGLLVPKLGEFISLTKRISLCLAAICVFMICLPLITIGLQNKAGFALCLICTFIIGS
FNSIAQNSCIGLASQVDGSLTGLYWVSTGISGLTMNAANAITLASFGDSDDGLKIGTIIY
FAIAVIITLLAIWSQIAFVKSDYYLDIKKQHEESGQDNEEDNTVSAISGEEETPLVGKKK
SIGEQLKAYGNKILSGIKLARFVPFFIYLIYVQTFMLFPGVSVFSKPSYTYLPGSWPTLV
MLTTYNVGDIIGKYICNFKFYNIPILYGVVISRFVFFVTFLMTMHQPDNSFFSNDAFAYV
NMLLFAITNGFCTGGLMFLGPTRGNNKKQAELIAFINSFSLTFGIACGSFLAPTLSG


>TTHERM_00221150(gene)
ATGTCTAGTGAACACCCTATCACTTTATAGCATAAGATCACATTCATTTTGTTGGGAATT
GCTTCTCTTATAGGATGGAATGCTATTTTGACTGCTTTAAGTTTCTTCTCAACATATTAT
CCTAAAGATGAATACGGCGGTGATGTATCTTTCTTATTCCCTATCCCTCTCTTTTTTGGT
AATTTTATTTGGGGTTTACTAGTTCCTAAGCTTGGTGAATTCATTTCTCTTACTAAGCGT
ATCTCTTTATGTTTAGCTGCTATCTGTGTATTTATGATCTGCTTACCTTTAATTACAATT
GGTCTCTAAAACAAGGCTGGCTTCGCACTTTGTTTGATCTGTACATTTATTATTGGTAGC
TTCAATAGTATTGCACAAAACTCTTGCATTGGTTTGGCTAGTTAAGTTGATGGTAGTTTG
ACTGGTAAATAATTTTATTTTTAATTCATTTATACATATTGATTTAACTTTAATGACTCT
ATCAATTTTCTTAGTAAATTATTTAATATTAATAATTGTTTATTATATGAAGGTTTATAT
TGGGTTTCTACTGGTATTAGTGGTTTAACTATGAATGCTGCTAATGCAATTACTTTAGCT
TCTTTTGGTGATTCAGATGATGGTTTAAAAATTGGAACAATTATTTATTTTGCTATTGCT
GTCATCATCACTCTTTTAGCAATATGGTCATAAATAGCATTTGTAAAAAGCGATTATTAC
TTGGACATCAAAAAGTAACATGAAGAGTCTGGATAAGATAATGAAGAGGACAATACAGTT
TCTGCTATATCAGGAGAAGAAGAAACTCCTCTTGTTGGAAAAAAGAAATCAATTGGAGAA
TAGCTCAAGGCATATGGCAACAAGATCCTCAGTGGTATTAAGCTTGCTCGTTTTGTACCC
TTTTTCATATACTTGATTTATGTTTAAACCTTCATGCTTTTCCCTGGTGTGTCTGTTTTT
AGCAAACCTTCCTATACCTACCTTCCTGGCAGTTGGCCTACGTAATTATTAGAAAATATA
TTTAAATTTCCTTTTAATTAACAGTTTTGAAATAACTTATTCTTTATACTTACATATTTG
TTTATTATTAAAATAGTCTAGTTATGTTAACAACTTACAATGTTGGTGATATTATCGGAA
AATACATTTGCAACTTCAAATTTTATAACATCCCTATTTTATATGGTGTTGTTATATCTA
GATTTGTTTTCTTTGTCACATTTTTAATGACTATGCACTAACCTGACAATTCTTTCTTTA
GTAATGATGCTTTTGCTTACGTTAATATGCTTTTATTTGCTATAACTAATGGTTTTTGTA
CAGGAGGTTTAATGTTCTTAGGACCTACCAGAGGTAACAATAAGAAATAAGCTGAATTGA
TTGCTTTCATTAACTCTTTCAGCTTGACTTTTGGTATAGCATGTGGATCTTTCCTAGCTC
CAACTCTTTCTGGTTGA