Identifiers and Description

Gene Model Identifier

TTHERM_01046910

Standard Name

NTP5 (Nucleoside transporter 5)

Aliases

PreTt05038 | 210.m00045

Description

Nucleoside transporter family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( TIGR00145 ) FTR1 family protein
  • ( PF01733 ) Nucleoside transporter
  • ( TIGR00939 ) Nucleoside Transporter
  • ( PF04018 ) Domain of unknown function (DUF368)
  • ( PF07690 ) transporter, major facilitator family
  • ( TIGR00881 ) phosphoglycerate transporter family protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.5%

TetraMine Data

TTHERM_01046910

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14076.19.997093137033517e-262nucleoside transporter (425 aa
)
OxytrichaContig18964.0.g302.0009605191578312e-25Nucleoside transporter
Stentor CoeruleusSteCoe_88360.0000000000018795288165390832
SGDYAL022C0.00000000030007160092483236FUN26 Vacuolar membrane transp
orter with broad nucleoside se
lectivity; may regulate balanc
e of nicotinamide riboside (Nm
R) levels between cytosol and
vacuole, contributing to salva
ge of NmR for use in cytosolic
NAD+ synthesis
DictyBaseDDB_G02815130.0000000010002658722841845DDB_G0281513 on chromosome: 3
position 4652073 to 4653629

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01046910(coding)
ATGGAAGACGCTAAATTAATTCAAGCTGCTAAGGACGATTTAAAGCCTACCCTTTTAAGC
AAAACAACTGCTGCTTTATTGGGAGTTTCTTCTTTGATTGGCTGGAGTGCTATTCTTAAT
TCGTTTGATTATTTCGGTAATAAATATCCAAAGGAAACTTACCATGACGTCACTTTCTTA
TTTCCAATTCCATTAAAGTTTGCTTCTTTTATATGGGGTTTGGCCATGGATTACCTTTCG
AAAAGATATTCGATCAAAATTAGAATTGGTCTTTGTCTTGGAATCTAATCTCTCTTTATG
ATTGCAATGCCACTTGTTGCTCTTCTTTTACAAAACTGGGCTGGTTTCTCAATTTGCATG
ATTTTATGTTTCTTAATAGGTACTACAACTTGCATCTCCTAGAATTCTAGTATTGCAATG
CTTTCTTAATTCGATAAAAAGAGTCAAGGAATTTACTGGATTTTTACTGCCTGGAGTGGA
CTTTCAATGAATGTAGGAAGAGCAATAGTGCTTGGTATTTTTGGTGATAACGATGCCGGA
ATTAATAATGGTACTATAGTTTACTTTGTCATGGCTGCCATTACTATTTATACAACCATT
TTCTGTCTTTTTAAATACTTAAAATCTGATCATCACTAAGAAATGATGGCTCTTCACTCC
GCTTAAGATACCGCTTATGAAAACACTACTGAATAAATAAACTATCAATCTGTTAGTGAC
TCTCCCAGCAGCAATCCAAACCAAGAACAATTAAAAGTTAGATTGATAGCATGCTTAAAG
AAAATTAAATTTATAGCTATTTCTATCTTTTTCACATATGTAGTGACTTTCATGCTTTTC
CCTGGTGTATCCATTTTCTAAAAATAATTCACTATTATTCAATCTTTGGCTTGGTTTAGT
GTATTAATGTAATTGTCTTACAATATTGGTGATTTATCAGGCAAGGCTTTGAGCAGTCTT
CATTTCTACAACTCTACTATGATGTATATTTTGAATATAAGCAGAGGCATCTTCTTCTTT
ACTTTCCTAATGAGTGCAAGAGATCCATCTAATGCCTTTTTTGGTAATGATTACTTTGCT
TTTGTTGATATATTTTTGTTTGGTCTTTCAAACGGACTCGTTACTGGCGGTCTCATGTAA
TTAGGACCTCAAAGAGGCTAAACTCCTGATGAAAAAAATTTAATTTCCTTAATTCTTGCA
TTTAGTCTGACTTTTGGTATATCTGTAGGAGCATTTTTGGCCCTCTCTCTTGAATAAAAT
TGA


>TTHERM_01046910(protein)
MEDAKLIQAAKDDLKPTLLSKTTAALLGVSSLIGWSAILNSFDYFGNKYPKETYHDVTFL
FPIPLKFASFIWGLAMDYLSKRYSIKIRIGLCLGIQSLFMIAMPLVALLLQNWAGFSICM
ILCFLIGTTTCISQNSSIAMLSQFDKKSQGIYWIFTAWSGLSMNVGRAIVLGIFGDNDAG
INNGTIVYFVMAAITIYTTIFCLFKYLKSDHHQEMMALHSAQDTAYENTTEQINYQSVSD
SPSSNPNQEQLKVRLIACLKKIKFIAISIFFTYVVTFMLFPGVSIFQKQFTIIQSLAWFS
VLMQLSYNIGDLSGKALSSLHFYNSTMMYILNISRGIFFFTFLMSARDPSNAFFGNDYFA
FVDIFLFGLSNGLVTGGLMQLGPQRGQTPDEKNLISLILAFSLTFGISVGAFLALSLEQN


>TTHERM_01046910(gene)
ATGGAAGACGCTAAATTAATTCAAGCTGCTAAGGACGATTTAAAGCCTACCCTTTTAAGC
AAAACAACTGCTGCTTTATTGGGAGTTTCTTCTTTGATTGGCTGGAGTGCTATTCTTAAT
TCGTTTGATTATTTCGGTAATAAATATCCAAAGGAAACTTACCATGACGTCACTTTCTTA
TTTCCAATTCCATTAAAGTTTGCTTCTTTTATATGGGGTTTGGCCATGGATTACCTTTCG
AAAAGATATTCGATCAAAATTAGAATTGGTCTTTGTCTTGGAATCTAATCTCTCTTTATG
ATTGCAATGCCACTTGTTGCTCTTCTTTTACAAAACTGGGCTGGTTTCTCAATTTGCATG
ATTTTATGTTTCTTAATAGGTACTACAACTTGCATCTCCTAGAATTCTAGTATTGCAATG
CTTTCTTAATTCGATAAAAAGAGTCAAGGTAAATAATTAATTAAATAAATAAATTTTAAA
AAAAATAACATATTTTAATTAAAATCCTTATTACCAATTAATTAATTTTGTTTGTTGATT
TAAATTTATAAATAAAAAAATAATTTTTATCTATAATTGCTATTAATTAAATGCGCATTT
TCTTTCTAAAAAAAATAATAATAATTTTTTCAAAAAAGGAATTTACTGGATTTTTACTGC
CTGGAGTGGACTTTCAATGAATGTAGGAAGAGCAATAGTGCTTGGTATTTTTGGTGATAA
CGATGCCGGAATTAATAATGGTACTATAGTTTACTTTGTCATGGCTGCCATTACTATTTA
TACAACCATTTTCTGTCTTTTTAAATACTTAAAATCTGATCATCACTAAGAAATGATGGC
TCTTCACTCCGCTTAAGATACCGCTTATGAAAACACTACTGAATAAATAAACTATCAATC
TGTTAGTGACTCTCCCAGCAGCAATCCAAACCAAGAACAATTAAAAGTTAGATTGATAGC
ATGCTTAAAGAAAATTAAATTTATAGCTATTTCTATCTTTTTCACATATGTAGTGACTTT
CATGCTTTTCCCTGGTGTATCCATTTTCTAAAAATAATTCACTATTATTCAATCTTTGGC
TTGGTTTAGGTAAATATTATTAAAACTTACTTTTACTTTCTATAGCAAATAAACTAAAAA
AAATTTATTGTATTCCAATTAAAATTAATTAAATTTATTAAAAAAAATAGTGTATTAATG
TAATTGTCTTACAATATTGGTGATTTATCAGGCAAGGCTTTGAGCAGTCTTCATTTCTAC
AACTCTACTATGATGTATATTTTGAATATAAGCAGAGGCATCTTCTTCTTTACTTTCCTA
ATGAGTGCAAGAGATCCATCTAATGCCTTTTTTGGTAATGATTACTTTGCTTTTGTTGAT
ATATTTTTGTTTGGTCTTTCAAACGGACTCGTTACTGGCGGTCTCATGTAATTAGGACCT
CAAAGAGGCTAAACTCCTGATGAAAAAAATTTAATTTCCTTAATTCTTGCATTTAGTCTG
ACTTTTGGTATATCTGTAGGAGCATTTTTGGCCCTCTCTCTTGAATAAAATTGA