Identifiers and Description

Gene Model Identifier

TTHERM_00147470

Standard Name

NTP4 (Nucleoside transporter 4)

Aliases

PreTt20605 | 12.m00279 | 3700.m00002

Description

Nucleoside transporter family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.8%

TetraMine Data

TTHERM_00147470

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10613.19.997093137033517e-262nucleoside transporter (494 aa
)
OxytrichaContig18964.0.g306.000802209040518e-34Nucleoside transporter
Stentor CoeruleusSteCoe_88360.000000000013887943864964021
SGDYAL022C0.0000000010002658722841845FUN26 Vacuolar membrane transp
orter with broad nucleoside se
lectivity; may regulate balanc
e of nicotinamide riboside (Nm
R) levels between cytosol and
vacuole, contributing to salva
ge of NmR for use in cytosolic
NAD+ synthesis
DictyBaseDDB_G02815130.000009999254677478949DDB_G0281513 on chromosome: 3
position 4652073 to 4653629

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00147470(coding)
ATGTCTAACGCTTTAGTCACTGAAGAAGTCTAAAATAAAAGCCCTAAGCAAGTTTACTAA
GAGTCCAACGATTTGATGCCTCAAGGTGAACAAGCAATTACCAAGTAAGTATCAAATGAT
TAATTGTACCTCGAATATGAAAAAGAACTCGCATAACCTTTACCTCCTCTCAAATTATGG
TATAAAGTTGCTTTTGTTTTTCTCGGTATTGCCTCTCTTGCTGGTTGGAATGCTATCTTA
ACAGCTTTTGATTTCTTTGGTCAAAAGTATCCCAAAGGCTAATTCTTGGATGTAACTTTC
TATTTCCCCATTCCAATTATGATTACAAACTTTTTGGCTGGTTTAGCTTGCCCTGCCTTA
GCTCGTCGTTTTAACTACAATCAAAGAATTGCTTACTGCTTAATGGGTGTCTGTTGTACT
ATGATCATAGTTACCATCATAGCTATCTTCTACAACACTACTGCAGGTTATTGGATCTCA
TTTTGCATTCTTTTCATTTAAGGATTTATCGATAGTGTTAATACTAACTCTTTGATTGCT
TTAGCTGGAAGTGTTCATCCCTCCATCAATAATATCTACTGGACAAGTACTGCTCTTTCT
GGTTTGACTATGAATGTTATCAGATTAATTGCTCTTGCCATTTTAGGAGATAGTGAACAA
TCTACTAACATTTGCACAGCCCTTTACTTCTGTTTTGCTGCTGTAATTTACATCTTCTCA
AGTATGATGCAAATTATTTTCACTAAGTGTGATTACTTCAAGCTCGTTGAAAGAAGATCT
TTCCTTAAAAACTAAATTGAAAACAAAATAACAACACAAACTGAAATGTAAAATGTTAGA
AGCACTGGAAATGTTTAAACTGATGTAAATCTTGATTAACATGAAAAATAAACTTCCTCT
CTTAAGAAAAATGCATTCTTCTAATATTTAGCTTACTTATCTTAAGTCTTCAAATACTCA
GGATGTATTCCTCTTTACTTAGTTCTTATCTATATCCAAACTTTCATGATGTTCCCAGGT
GTTTCTATCTTCCAAAAGACTACATACGAAATTATTAAATTCCCTTGGGCTGGTGTTTTT
ATGATTTTACTCTTTAATCTCGGTGATCTAGTAGGAAAATACATTGGAGGCATAAAGATG
CTTTAAAAATTATACTTAACTTACTCTATTGTTATTAGTAGATTTATTTTCTACGTTTTC
TTCTTACTTATTTCTAGACATAAAGGTAGCGAAGATTTATAAAATGATGTCTTTTCATGG
TTCTGTATTTTCTTATTTGCAGTAACTAATGGTTAGTGCACAACTGCTCTCATGAATCTT
GGACCTAAAAATGTTAAGGACCCTAAAATAGTTGACCTTATCAACTTTATTGGTGGATTC
GCTATTACTTTTGGTATTTCTATTGGTACATTTTTAGCTCTTCCTCTTGTATAAGAGTGA


>TTHERM_00147470(protein)
MSNALVTEEVQNKSPKQVYQESNDLMPQGEQAITKQVSNDQLYLEYEKELAQPLPPLKLW
YKVAFVFLGIASLAGWNAILTAFDFFGQKYPKGQFLDVTFYFPIPIMITNFLAGLACPAL
ARRFNYNQRIAYCLMGVCCTMIIVTIIAIFYNTTAGYWISFCILFIQGFIDSVNTNSLIA
LAGSVHPSINNIYWTSTALSGLTMNVIRLIALAILGDSEQSTNICTALYFCFAAVIYIFS
SMMQIIFTKCDYFKLVERRSFLKNQIENKITTQTEMQNVRSTGNVQTDVNLDQHEKQTSS
LKKNAFFQYLAYLSQVFKYSGCIPLYLVLIYIQTFMMFPGVSIFQKTTYEIIKFPWAGVF
MILLFNLGDLVGKYIGGIKMLQKLYLTYSIVISRFIFYVFFLLISRHKGSEDLQNDVFSW
FCIFLFAVTNGQCTTALMNLGPKNVKDPKIVDLINFIGGFAITFGISIGTFLALPLVQE


>TTHERM_00147470(gene)
ATGTCTAACGCTTTAGTCACTGAAGAAGTCTAAAATAAAAGCCCTAAGCAAGTTTACTAA
GAGTCCAACGATTTGATGCCTCAAGGTGAACAAGCAATTACCAAGTAAGTATCAAATGAT
TAATTGTACCTCGAATATGAAAAAGAACTCGCATAACCTTTACCTCCTCTCAAATTATGG
TATAAAGTTGCTTTTGTTTTTCTCGGTATTGCCTCTCTTGCTGGTTGGAATGCTATCTTA
ACAGCTTTTGATTTCTTTGGTCAAAAGTATCCCAAAGGCTAATTCTTGGATGTAACTTTC
TATTTCCCCATTCCAATTATGATTACAAACTTTTTGGCTGGTTTAGCTTGCCCTGCCTTA
GCTCGTCGTTTTAACTACAATCAAAGAATTGCTTACTGCTTAATGGGTGTCTGTTGTACT
ATGATCATAGTTACCATCATAGCTATCTTCTACAACACTACTGCAGGTTATTGGATCTCA
TTTTGCATTCTTTTCATTTAAGGATTTATCGATAGTGTTAATACTAACTCTTTGATTGCT
TTAGCTGGAAGTGTTCATCCCTCCATCAATAATATCTACTGGACAAGTACTGCTCTTTCT
GGTTTGACTATGAATGTTATCAGATTAATTGCTCTTGCCATTTTAGGAGATAGTGAACAA
TCTACTAACATTTGCACAGCCCTTTACTTCTGTTTTGCTGCTGTAATTTACATCTTCTCA
AGTATGATGCAAATTATTTTCACTAAGTGTGATTACTTCAAGCTCGTTGAAAGAAGATCT
TTCCTTAAAAACTAAATTGAAAACAAAATAACAACACAAACTGAAATGTAAAATGTTAGA
AGCACTGGAAATGTTTAAACTGATGTAAATCTTGATTAACATGAAAAATAAACTTCCTCT
CTTAAGAAAAATGCATTCTTCTAATATTTAGCTTACTTATCTTAAGTCTTCAAATACTCA
GGATGTATTCCTCTTTACTTAGTTCTTATCTATATCCAAACTTTCATGATGTTCCCAGGT
GTTTCTATCTTCCAAAAGACTACATACGAAATTATTAAATTCCCTTGGGCTGGGTAAATA
TTAAATTTTTTTTTTCTTTTCAAAATTTTGTTATTCTCTACTTACTAATTATTCAATACT
AATAAATTCTTATTTAAATTAATAGTGTTTTTATGATTTTACTCTTTAATCTCGGTGATC
TAGTAGGAAAATACATTGGAGGCATAAAGATGCTTTAAAAATTATACTTAACTTACTCTA
TTGTTATTAGTAGATTTATTTTCTACGTTTTCTTCTTACTTATTTCTAGACATAAAGGTA
GCGAAGATTTATAAAATGATGTCTTTTCATGGTTCTGTATTTTCTTATTTGCAGTAACTA
ATGGTTAGTGCACAACTGCTCTCATGAATCTTGGACCTAAAAATGTTAAGGACCCTAAAA
TAGTTGACCTTATCAACTTTATTGGTGGATTCGCTATTACTTTTGGTATTTCTATTGGTA
CATTTTTAGCTCTTCCTCTTGTATAAGAGTGA