Identifiers and Description

Gene Model Identifier

TTHERM_00971780

Standard Name

NTP3 (Nucleoside transporter 3)

Aliases

PreTt01448 | 180.m00068 | 3749.m00266

Description

NTP3 equilibrative nucleoside transporter family protein; Nucleoside transporter family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00971780

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20013.19.997093137033517e-262nucleoside transporter (493 aa
)
OxytrichaContig18964.0.g302.000470901975128e-28Nucleoside transporter
DictyBaseDDB_G02834390.000030009396760408108DDB_G0283439 on chromosome: 4
position 699253 to 700845

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00971780(coding)
ATGGGTATATCACCCGAATCTTCGGAGTAAAATAAAACTTCAATGACATTTATGGATAAA
AAACAAGAACTTTAAGATAGCTAAAAGAGAATATTGAATGATAATAAGAAAGTTAAATTT
GATGATTCAAATAAACAAATTATAGAGCTAAATAAATTACTTGATAGATTAAATCCTCAA
CTAAAAGGCTGGCATAGATTAGCTTTTGTCTTGCTTGGCATAGCATCACTAGCTGGTTGG
AATGCAATATTATCTGCTATTGATTTTTTCTAAGCGTAATATCCCAAGGATAAATTTATG
GATGTATCATTTTATTTTCCTGTTCCAATTATGTTAGCAAACTGCTTAGCAGCTTTCGTT
TGCCCAGCTTTAGCGCGTTTCTTTTCATTAAATTAAAGAATAGCATATACGCTTATGGGT
ACTTGCTTAACTATGGTTTCAGTCACTATGATTGCAATTTTCTTCAATACTCAAATGGGA
TTTTGGATTTCCTTTGTGATACTTATCATTTAAGGATTTATTGATTGTGTTAATACAAGT
TCATTGATATCTCTATCAGGGATGGTAGACTCAACGCTTAATAACACTTACTGGACTTGT
ACTGCTTTCTCAGGTTTAACTACAAATTTTTTGAGAATGATTACTCTTGCTTGGTTTGGT
GATGGGTAATCAGCAATTAATACAGGTTCAGCTCTTTACTTTTCAATAGCTGCTTTCGTA
TACGTAGTATCAAGTACACTCTAAGTTCTATTTGCTGATAGTGAATACTTCCACATAATA
TTGAAGAGACAGAAAGTGTATTCTAAAATAGAAGAAATTAAAAGAATATAAGCCATAAAT
AGTGATTTGTAATAATAAACAACTGCACATAATATTTCTTAAATATATGATTAATAAACA
CAAAAAATAAAAATTCTATATACAATAAAGCAAAATCCTATCATTAATTACTTCTTAGAG
ATAAAGCAAGTTTTTAAATACGCTGGCGCCATTCCTGTTTTTATAACTATTATTTACATA
CAGACCTTTATGGTATTCCCTGGAGTTTCAATCTTTTAAAAAAAACCATATCATATTGTC
GGCTAGACTTGGGCACAAGTTGTTATGATAACTATTTTTAACTTAGGAGATGTCGTCGGA
AAGTTTTCTGGATTTTACAAATCCTTACACAAACTTTATTTTGTTTACTCTGTAGTTCTT
TTAAGATTTATTTTCTTCTCTTTCTTTATAATAACTGCTAAGAGATAGGATCTAGAATTT
TTCTAGAACGATTTCTTTGCAATGATTAACATGTTTCTATTTGCCTTAGCAAATGGATTT
GGAACAACAGCTCTAATGAATCTAGGAACAAAAAACACTAGTGACCCTAAAATTACAGAT
CTCATCAATTATTATGGTGGATTTGCCATAGCTTTTGGAATCATGATAGGAACATTTTTA
TCTCTTCCCCTAAACTCATTTGTTGATTCTTCTTGA


>TTHERM_00971780(protein)
MGISPESSEQNKTSMTFMDKKQELQDSQKRILNDNKKVKFDDSNKQIIELNKLLDRLNPQ
LKGWHRLAFVLLGIASLAGWNAILSAIDFFQAQYPKDKFMDVSFYFPVPIMLANCLAAFV
CPALARFFSLNQRIAYTLMGTCLTMVSVTMIAIFFNTQMGFWISFVILIIQGFIDCVNTS
SLISLSGMVDSTLNNTYWTCTAFSGLTTNFLRMITLAWFGDGQSAINTGSALYFSIAAFV
YVVSSTLQVLFADSEYFHIILKRQKVYSKIEEIKRIQAINSDLQQQTTAHNISQIYDQQT
QKIKILYTIKQNPIINYFLEIKQVFKYAGAIPVFITIIYIQTFMVFPGVSIFQKKPYHIV
GQTWAQVVMITIFNLGDVVGKFSGFYKSLHKLYFVYSVVLLRFIFFSFFIITAKRQDLEF
FQNDFFAMINMFLFALANGFGTTALMNLGTKNTSDPKITDLINYYGGFAIAFGIMIGTFL
SLPLNSFVDSS


>TTHERM_00971780(gene)
ATGGGTATATCACCCGAATCTTCGGAGTAAAATAAAACTTCAATGACATTTATGGATAAA
AAACAAGAACTTTAAGATAGCTAAAAGAGAATATTGAATGATAATAAGAAAGTTAAATTT
GATGATTCAAATAAACAAATTATAGAGCTAAATAAATTACTTGATAGATTAAATCCTCAA
CTAAAAGGCTGGCATAGATTAGCTTTTGTCTTGCTTGGCATAGCATCACTAGCTGGTTGG
AATGCAATATTATCTGCTATTGATTTTTTCTAAGCGTAATATCCCAAGGATAAATTTATG
GATGTATCATTTTATTTTCCTGTTCCAATTATGTTAGCAAACTGCTTAGCAGCTTTCGTT
TGCCCAGCTTTAGCGCGTTTCTTTTCATTAAATTAAAGAATAGCATATACGCTTATGGGT
ACTTGCTTAACTATGGTTTCAGTCACTATGATTGCAATTTTCTTCAATACTCAAATGGGA
TTTTGGATTTCCTTTGTGATACTTATCATTTAAGGATTTATTGATTGTGTTAATACAAGT
TCATTGATATCTCTATCAGGGATGGTAGACTCAACGCTTAATAACACTTACTGGACTTGT
ACTGCTTTCTCAGGTTTAACTACAAATTTTTTGAGAATGATTACTCTTGCTTGGTTTGGT
GATGGGTAATCAGCAATTAATACAGGTTCAGCTCTTTACTTTTCAATAGCTGCTTTCGTA
TACGTAGTATCAAGTACACTCTAAGTTCTATTTGCTGATAGTGAATACTTCCACATAATA
TTGAAGAGACAGAAAGTGTATTCTAAAATAGAAGAAATTAAAAGAATATAAGCCATAAAT
AGTGATTTGTAATAATAAACAACTGCACATAATATTTCTTAAATATATGATTAATAAACA
CAAAAAATAAAAATTCTATATACAATAAAGCAAAATCCTATCATTAATTACTTCTTAGAG
ATAAAGCAAGTTTTTAAATACGCTGGCGCCATTCCTGTTTTTATAACTATTATTTACATA
CAGACCTTTATGGTATTCCCTGGAGTTTCAATCTTTTAAAAAAAACCATATCATATTGTC
GGCTAGACTTGGGCACAGTAAAATTTATTTCTATTTATTTTAATTAAAAAGTAAAGGCAT
ACATACAGACTACTAAAAAAAATACACTTTTCGACTTATTAAATTTGTATTTTTAATCAA
ATTAATTATAATTTTTTAATAAAAATAGAGTTGTTATGATAACTATTTTTAACTTAGGAG
ATGTCGTCGGAAAGTTTTCTGGATTTTACAAATCCTTACACAAACTTTATTTTGTTTACT
CTGTAGTTCTTTTAAGATTTATTTTCTTCTCTTTCTTTATAATAACTGCTAAGAGATAGG
ATCTAGAATTTTTCTAGAACGATTTCTTTGCAATGATTAACATGTTTCTATTTGCCTTAG
CAAATGGATTTGGAACAACAGCTCTAATGAATCTAGGAACAAAAAACACTAGTGACCCTA
AAATTACAGATCTCATCAATTATTATGGTGGATTTGCCATAGCTTTTGGAATCATGATAG
GAACATTTTTATCTCTTCCCCTAAACTCATTTGTTGATTCTTCTTGA