Identifiers and Description

Gene Model Identifier

TTHERM_00463710

Standard Name

NTP2 (Nucleoside transporter 2)

Aliases

PreTt25823 | 54.m00279 | 3823.m01189

Description

NTP2 equilibrative nucleoside transporter family protein; Nucleoside transporter family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 18.4%

TetraMine Data

TTHERM_00463710

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10695.19.997093137033517e-262nucleoside transporter (426 aa
)
OxytrichaContig18964.0.g302.000130478826482e-26Nucleoside transporter
DictyBaseDDB_G02834390.000000000029994712494008525DDB_G0283439 on chromosome: 4
position 699253 to 700845
WormBaseWBGene000081230.0007999190683310628locus:ent-6 status:Confirmed
UniProt:Q7JKL2 protein_id
:CAE46670.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00463710(coding)
ATGAAATAAAAAATATCTGATATTGCTAAACATACCCCTCTTACTAAAATCACATTTGCT
CTTCTCGGAACTAACACTTTATTAGGCTGGAGCGCTGTTTTAACATCTTTTGATTACTTT
AGTGACAAATTCCCTTAAGATGAGTTTCCTGATGTTGCATTTTACTTTCCAATCCCATTG
AAAATAGGAACTTTTATTTGGACTTTTGCAATGGCCTTTTTGATGAAGCATATATCTTTA
AAATTTAGAATATGTGGATTCATTGCTATTTAAGGAGTTTTAATGATGCTCTTACCTATA
ATTGCAAATTATATGTAGACCAATTTAGGTTACGCTTTAATGATAACTATTTGCTTTCTA
GTCGGATCAACTGCATGTATTGTTCAAAATTCAAACCTCGCTCTTGTCTCAAATTTTGAT
AAGCTAAGCTTGAAACTATATTGGGTATTTACTTCTATAACTCAATTGATTATGAATCTA
TGCAGAGCTATCATTCTTGTAATTTTTGGTGACAATTAGGAAGGTATTAATACAGGAATA
TTTGTTTATTATGCAGTTGCTGATCTTGTGATGATAATAACTATAATTTCAGTTATAAAA
TTCCTAAAAACATCATTTTATCTGGATATGCTTGAAATAAATAAATTACAATTATAAAAC
GAAAGCGAAAACACTGATGATGAAAACCAAGTATAATAATAAGAATCGATTTCTAATCTA
TCTTCTAGCTAAATTTAACATCAAGCTGAGTAGTCTTTGCTCTAAAAATAAAATAAAATT
TAAATGGCTAAAAATTGTTTCATGAAAGTGAAATTCATTTGTTTTTCAATTTTATTGACT
TACATTATTTAATACATGCTTTTCCCAGGAGTGGCTGTTTTCTAAAAATAATATCATATG
ATTCATTCTAAAGCTTGGGCTACTTTGAGCATGCAAATAGTTTACAGTGTTGGAGACTTA
GTTGGAAAGTATCTGAGTACATTTAATTTTTATAATACTACCGCTCTCTATGCGATATCC
TTAAGCAGATTATTCTTATTCTTTACATTTTTAATGATTGCTCATGATTATGAATCTTCC
TTCTTTTAGAATGACATATTTGCCTTCATTAATATATTTAGCTTAAGTTTTACTAATGGA
TTTGTTACAGGAGGGTTTATGACAATTGGTCCTCAAAGAGGTTCTAATAACTAAGAAAGA
AGCTTAATATCAATAATCTAAACTTTCTTCTTGACATTTGGAATTTCTGTAGGCACATTT
TTAGCTCTTACACTAAAATTTTGA


>TTHERM_00463710(protein)
MKQKISDIAKHTPLTKITFALLGTNTLLGWSAVLTSFDYFSDKFPQDEFPDVAFYFPIPL
KIGTFIWTFAMAFLMKHISLKFRICGFIAIQGVLMMLLPIIANYMQTNLGYALMITICFL
VGSTACIVQNSNLALVSNFDKLSLKLYWVFTSITQLIMNLCRAIILVIFGDNQEGINTGI
FVYYAVADLVMIITIISVIKFLKTSFYLDMLEINKLQLQNESENTDDENQVQQQESISNL
SSSQIQHQAEQSLLQKQNKIQMAKNCFMKVKFICFSILLTYIIQYMLFPGVAVFQKQYHM
IHSKAWATLSMQIVYSVGDLVGKYLSTFNFYNTTALYAISLSRLFLFFTFLMIAHDYESS
FFQNDIFAFINIFSLSFTNGFVTGGFMTIGPQRGSNNQERSLISIIQTFFLTFGISVGTF
LALTLKF


>TTHERM_00463710(gene)
ATGAAATAAAAAATATCTGATATTGCTAAACATACCCCTCTTACTAAAATCACATTTGCT
CTTCTCGGAACTAACACTTTATTAGGCTGGAGCGCTGTTTTAACATCTTTTGATTACTTT
AGTGACAAATTCCCTTAAGATGAGTTTCCTGATGTTGCATTTTACTTTCCAATCCCATTG
AAAATAGGAACTTTTATTTGGACTTTTGCAATGGCCTTTTTGATGAAGCATATATCTTTA
AAATTTAGAATATGTGGATTCATTGCTATTTAAGGAGTTTTAATGATGCTCTTACCTATA
ATTGCAAATTATATGTAGACCAATTTAGGTTACGCTTTAATGATAACTATTTGCTTTCTA
GTCGGATCAACTGCATGTATTGTTCAAAATTCAAACCTCGCTCTTGTCTCAAATTTTGAT
AAGCTAAGCTTGAGTAAATAAACATTTTTCAAAATTAAAATTTCTTTTATATTTAAATTT
ACCTTTTTATTAATAGAACTATATTGGGTATTTACTTCTATAACTCAATTGATTATGAAT
CTATGCAGAGCTATCATTCTTGTAATTTTTGGTGACAATTAGGAAGGTATTAATACAGGA
ATATTTGTTTATTATGCAGTTGCTGATCTTGTGATGATAATAACTATAATTTCAGTTATA
AAATTCCTAAAAACATCATTTTATCTGGATATGCTTGAAATAAATAAATTACAATTATAA
AACGAAAGCGAAAACACTGATGATGAAAACCAAGTATAATAATAAGAATCGATTTCTAAT
CTATCTTCTAGCTAAATTTAACATCAAGCTGAGTAGTCTTTGCTCTAAAAATAAAATAAA
ATTTAAATGGCTAAAAATTGTTTCATGAAAGTGAAATTCATTTGTTTTTCAATTTTATTG
ACTTACATTATTTAATACATGCTTTTCCCAGGAGTGGCTGTTTTCTAAAAATAATATCAT
ATGATTCATTCTAAAGCTTGGGCTACGTAAATAAATATTTTTATTCAAATAACCTTTCTA
ATAATAAATTTATTAAATTAGTTTGAGCATGCAAATAGTTTACAGTGTTGGAGACTTAGT
TGGAAAGTATCTGAGTACATTTAATTTTTATAATACTACCGCTCTCTATGCGATATCCTT
AAGCAGATTATTCTTATTCTTTACATTTTTAATGATTGCTCATGATTATGAATCTTCCTT
CTTTTAGAATGACATATTTGCCTTCATTAATATATTTAGCTTAAGTTTTACTAATGGATT
TGTTACAGGAGGGTTTATGACAATTGGTCCTCAAAGAGGTTCTAATAACTAAGAAAGAAG
CTTAATATCAATAATCTAAACTTTCTTCTTGACATTTGGAATTTCTGTAGGCACATTTTT
AGCTCTTACACTAAAATTTTGA