Identifiers and Description

Gene Model Identifier

TTHERM_00463710

Standard Name

NTP2 (Nucleoside transporter 2)

Aliases

PreTt25823 | 54.m00279 | 3823.m01189

Description

Nucleoside transporter family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 18.4%

TetraMine Data

TTHERM_00463710

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10695.19.997093137033517e-262nucleoside transporter (426 aa
)
OxytrichaContig18964.0.g302.000130478826482e-26Nucleoside transporter
DictyBaseDDB_G02834390.000000000029994712494008525DDB_G0283439 on chromosome: 4
position 699253 to 700845
WormBaseWBGene000081230.0007999190683310628locus:ent-6 status:Confirmed
UniProt:Q7JKL2 protein_id
:CAE46670.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00463710(coding)
ATGAAATAAAAAATATCTGATATTGCTAAACATACCCCTCTTACTAAAATCACATTTGCT
CTTCTCGGAACTAACACTTTATTAGGCTGGAGCGCTGTTTTAACATCTTTTGATTACTTT
AGTGACAAATTCCCTTAAGATGAGTTTCCTGATGTTGCATTTTACTTTCCAATCCCATTG
AAAATAGGAACTTTTATTTGGACTTTTGCAATGGCCTTTTTGATGAAGCATATATCTTTA
AAATTTAGAATATGTGGATTCATTGCTATTTAAGGAGTTTTAATGATGCTCTTACCTATA
ATTGCAAATTATATGTAGACCAATTTAGGTTACGCTTTAATGATAACTATTTGCTTTCTA
GTCGGATCAACTGCATGTATTGTTCAAAATTCAAACCTCGCTCTTGTCTCAAATTTTGAT
AAGCTAAGCTTGAAACTATATTGGGTATTTACTTCTATAACTCAATTGATTATGAATCTA
TGCAGAGCTATCATTCTTGTAATTTTTGGTGACAATTAGGAAGGTATTAATACAGGAATA
TTTGTTTATTATGCAGTTGCTGATCTTGTGATGATAATAACTATAATTTCAGTTATAAAA
TTCCTAAAAACATCATTTTATCTGGATATGCTTGAAATAAATAAATTACAATTATAAAAC
GAAAGCGAAAACACTGATGATGAAAACCAAGTATAATAATAAGAATCGATTTCTAATCTA
TCTTCTAGCTAAATTTAACATCAAGCTGAGTAGTCTTTGCTCTAAAAATAAAATAAAATT
TAAATGGCTAAAAATTGTTTCATGAAAGTGAAATTCATTTGTTTTTCAATTTTATTGACT
TACATTATTTAATACATGCTTTTCCCAGGAGTGGCTGTTTTCTAAAAATAATATCATATG
ATTCATTCTAAAGCTTGGGCTACTTTGAGCATGCAAATAGTTTACAGTGTTGGAGACTTA
GTTGGAAAGTATCTGAGTACATTTAATTTTTATAATACTACCGCTCTCTATGCGATATCC
TTAAGCAGATTATTCTTATTCTTTACATTTTTAATGATTGCTCATGATTATGAATCTTCC
TTCTTTTAGAATGACATATTTGCCTTCATTAATATATTTAGCTTAAGTTTTACTAATGGA
TTTGTTACAGGAGGGTTTATGACAATTGGTCCTCAAAGAGGTTCTAATAACTAAGAAAGA
AGCTTAATATCAATAATCTAAACTTTCTTCTTGACATTTGGAATTTCTGTAGGCACATTT
TTAGCTCTTACACTAAAATTTTGA


>TTHERM_00463710(protein)
MKQKISDIAKHTPLTKITFALLGTNTLLGWSAVLTSFDYFSDKFPQDEFPDVAFYFPIPL
KIGTFIWTFAMAFLMKHISLKFRICGFIAIQGVLMMLLPIIANYMQTNLGYALMITICFL
VGSTACIVQNSNLALVSNFDKLSLKLYWVFTSITQLIMNLCRAIILVIFGDNQEGINTGI
FVYYAVADLVMIITIISVIKFLKTSFYLDMLEINKLQLQNESENTDDENQVQQQESISNL
SSSQIQHQAEQSLLQKQNKIQMAKNCFMKVKFICFSILLTYIIQYMLFPGVAVFQKQYHM
IHSKAWATLSMQIVYSVGDLVGKYLSTFNFYNTTALYAISLSRLFLFFTFLMIAHDYESS
FFQNDIFAFINIFSLSFTNGFVTGGFMTIGPQRGSNNQERSLISIIQTFFLTFGISVGTF
LALTLKF


>TTHERM_00463710(gene)
ATGAAATAAAAAATATCTGATATTGCTAAACATACCCCTCTTACTAAAATCACATTTGCT
CTTCTCGGAACTAACACTTTATTAGGCTGGAGCGCTGTTTTAACATCTTTTGATTACTTT
AGTGACAAATTCCCTTAAGATGAGTTTCCTGATGTTGCATTTTACTTTCCAATCCCATTG
AAAATAGGAACTTTTATTTGGACTTTTGCAATGGCCTTTTTGATGAAGCATATATCTTTA
AAATTTAGAATATGTGGATTCATTGCTATTTAAGGAGTTTTAATGATGCTCTTACCTATA
ATTGCAAATTATATGTAGACCAATTTAGGTTACGCTTTAATGATAACTATTTGCTTTCTA
GTCGGATCAACTGCATGTATTGTTCAAAATTCAAACCTCGCTCTTGTCTCAAATTTTGAT
AAGCTAAGCTTGAGTAAATAAACATTTTTCAAAATTAAAATTTCTTTTATATTTAAATTT
ACCTTTTTATTAATAGAACTATATTGGGTATTTACTTCTATAACTCAATTGATTATGAAT
CTATGCAGAGCTATCATTCTTGTAATTTTTGGTGACAATTAGGAAGGTATTAATACAGGA
ATATTTGTTTATTATGCAGTTGCTGATCTTGTGATGATAATAACTATAATTTCAGTTATA
AAATTCCTAAAAACATCATTTTATCTGGATATGCTTGAAATAAATAAATTACAATTATAA
AACGAAAGCGAAAACACTGATGATGAAAACCAAGTATAATAATAAGAATCGATTTCTAAT
CTATCTTCTAGCTAAATTTAACATCAAGCTGAGTAGTCTTTGCTCTAAAAATAAAATAAA
ATTTAAATGGCTAAAAATTGTTTCATGAAAGTGAAATTCATTTGTTTTTCAATTTTATTG
ACTTACATTATTTAATACATGCTTTTCCCAGGAGTGGCTGTTTTCTAAAAATAATATCAT
ATGATTCATTCTAAAGCTTGGGCTACGTAAATAAATATTTTTATTCAAATAACCTTTCTA
ATAATAAATTTATTAAATTAGTTTGAGCATGCAAATAGTTTACAGTGTTGGAGACTTAGT
TGGAAAGTATCTGAGTACATTTAATTTTTATAATACTACCGCTCTCTATGCGATATCCTT
AAGCAGATTATTCTTATTCTTTACATTTTTAATGATTGCTCATGATTATGAATCTTCCTT
CTTTTAGAATGACATATTTGCCTTCATTAATATATTTAGCTTAAGTTTTACTAATGGATT
TGTTACAGGAGGGTTTATGACAATTGGTCCTCAAAGAGGTTCTAATAACTAAGAAAGAAG
CTTAATATCAATAATCTAAACTTTCTTCTTGACATTTGGAATTTCTGTAGGCACATTTTT
AGCTCTTACACTAAAATTTTGA