Identifiers and Description

Gene Model Identifier

TTHERM_00907060

Standard Name

NTP13 (Nucleoside transporter 13)

Aliases

PreTt22206 | 161.m00112

Description

Nucleoside transporter family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF01461 ) 7TM chemoreceptor
  • ( PF01733 ) Nucleoside transporter
  • ( TIGR00939 ) Nucleoside Transporter
  • ( PF07695 ) 7TM diverse intracellular signalling
  • ( PF07690 ) transporter, major facilitator family
  • ( PF04610 ) TrbL/VirB6 plasmid conjugal transfer protein
  • ( TIGR02872 ) sporulation integral membrane protein YtvI
  • ( PF00499 ) NADH-ubiquinone/plastoquinone oxidoreductase chain 6

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00907060

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14076.11.9994249217050915e-157nucleoside transporter (425 aa
)
OxytrichaContig18964.0.g303.999970367130025e-21Nucleoside transporter
SGDYAL022C0.00000019998969434520019FUN26 Vacuolar membrane transp
orter with broad nucleoside se
lectivity; may regulate balanc
e of nicotinamide riboside (Nm
R) levels between cytosol and
vacuole, contributing to salva
ge of NmR for use in cytosolic
NAD+ synthesis
DictyBaseDDB_G02834390.000000600201742947405DDB_G0283439 on chromosome: 4
position 699253 to 700845

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00907060(coding)
ATGGAAAAAACCAAGCTACTTGAAGATAAATTTTCTTATTAAACCACTTTCTTGAGTAAA
ATAACATCTGCGTTATTAGGAATTTCGACTCTTATTGCATGGAGTGCTATTTTGAATTCT
TTTGACTTCTTTCTTTTTAAATACCCTAAAGAGATTTTTCATGATGTCACATTTTTGTTT
CCTATTCCTTTAAGATTTGCTACGTTCATTTGGGGTTTAGCTATGGGTAAGATATATAAA
AAATATTCTATCAAGATTAATATTGGACTTTCATTGTTGATTTAATCACTTTTAATCGTC
ATACTGGTTATTACTGCTCAATTTATTGAAAATGTATATGGATTGATTATATGCATGGTG
CTTTGTTTTATCATTGGAACATTTAATTGTATTTCTTAAAATTGTAGTATAGCATTTATC
TCTCAATTCGACAAAAGTAACCAAGGAATTTTTTGGATATTCACTTCTTTGAGCGGACTT
TCCATGAATTTTGCTAGAGTAGTTATATTAGCTATTTGTGGAAAAGATGAAGATGGAATT
ACTAAAAGAACATTGACTTGCTTTATAATAGCATGCCTGATAATTTATGCTACCATTTTC
TCTCTATTCAAATTCTTAAAATCTGAATAAAATAATTAATATTCTCATTCAAGAAGTACA
AGTACCACAGAAACAGTAGTAAAAAGCACTTTAGAAAGTTAAAGCGAAGAAATAACTATT
GAATTTACTGAAAACGAGCAAATTTAATCCAAACCTAGCTTTAAGAGTTGCTTAAAAAGT
GTGAGATACATAGCGCTCTTTCTTTTTACTAACTATGTAATTAGTTTTATGTTATTTCCA
GGTGTTTCAATATATTAAAAAAGATATTCGTTTATAGATTCGTTGGCTTGGTCAAGTCTT
ATAATGTAAATTTTATTTAATCTTGGAGACTTCTTTGGAAAAATAGTCAGTAGCTTTCAT
TTTTATAGTTCAGTTCTGCTTTATACTTTAACTATTTTAAGAGGCATATTTTTCTATACA
TTTTTGATGTCTGCAAGAGAACCCGATAACTAATTCTTTCGAAACGATTATTTTGCTATG
GTAGACATTTTTATATTTGGTTTGACACATGGCTTTGTAGCGAGCGGTCTTATGTAAATA
GGAGCAAAAAAAAGTTCTAATCTTGAAGAAAAAAATATAATTTCATTTATTTTGGCGTTT
TTCTTTACATTAGGTTTGTCTGCAGGTACTTTTTTAGCATTAATTCTAGAAGAACATTGA


>TTHERM_00907060(protein)
MEKTKLLEDKFSYQTTFLSKITSALLGISTLIAWSAILNSFDFFLFKYPKEIFHDVTFLF
PIPLRFATFIWGLAMGKIYKKYSIKINIGLSLLIQSLLIVILVITAQFIENVYGLIICMV
LCFIIGTFNCISQNCSIAFISQFDKSNQGIFWIFTSLSGLSMNFARVVILAICGKDEDGI
TKRTLTCFIIACLIIYATIFSLFKFLKSEQNNQYSHSRSTSTTETVVKSTLESQSEEITI
EFTENEQIQSKPSFKSCLKSVRYIALFLFTNYVISFMLFPGVSIYQKRYSFIDSLAWSSL
IMQILFNLGDFFGKIVSSFHFYSSVLLYTLTILRGIFFYTFLMSAREPDNQFFRNDYFAM
VDIFIFGLTHGFVASGLMQIGAKKSSNLEEKNIISFILAFFFTLGLSAGTFLALILEEH


>TTHERM_00907060(gene)
ATGGAAAAAACCAAGCTACTTGAAGATAAATTTTCTTATTAAACCACTTTCTTGAGTAAA
ATAACATCTGCGTTATTAGGAATTTCGACTCTTATTGCATGGAGTGCTATTTTGAATTCT
TTTGACTTCTTTCTTTTTAAATACCCTAAAGAGATTTTTCATGATGTCACATTTTTGTTT
CCTATTCCTTTAAGATTTGCTACGTTCATTTGGGGTTTAGCTATGGGTAAGATATATAAA
AAATATTCTATCAAGATTAATATTGGACTTTCATTGTTGATTTAATCACTTTTAATCGTC
ATACTGGTTATTACTGCTCAATTTATTGAAAATGTATATGGATTGATTATATGCATGGTG
CTTTGTTTTATCATTGGAACATTTAATTGTATTTCTTAAAATTGTAGTATAGCATTTATC
TCTCAATTCGACAAAAGTAACCAAGGTATTAATTAATTTATAATTACAAATAAATATCAT
AGTCTTAATAATTACTAAAAAAAGGAATTTTTTGGATATTCACTTCTTTGAGCGGACTTT
CCATGAATTTTGCTAGAGTAGTTATATTAGCTATTTGTGGAAAAGATGAAGATGGAATTA
CTAAAAGAACATTGACTTGCTTTATAATAGCATGCCTGATAATTTATGCTACCATTTTCT
CTCTATTCAAATTCTTAAAATCTGAATAAAATAATTAATATTCTCATTCAAGAAGTACAA
GTACCACAGAAACAGTAGTAAAAAGCACTTTAGAAAGTTAAAGCGAAGAAATAACTATTG
AATTTACTGAAAACGAGCAAATTTAATCCAAACCTAGCTTTAAGAGTTGCTTAAAAAGTG
TGAGATACATAGCGCTCTTTCTTTTTACTAACTATGTAATTAGTTTTATGTTATTTCCAG
GTGTTTCAATATATTAAAAAAGATATTCGTTTATAGATTCGTTGGCTTGGTCAAGGTAAA
TAATTCAATATTTGTCAAAGCAAATTTATTAGGAAAATTTAAATAAAATATATTTTTATT
TGGATTGATTGAAAGTGAAATAGAAAATATTTATATATTGAAAAATATATTTTAAAATAA
AACATTTATTTAAAAATCAAATAAATCAAAAATTTTTATTAGAAGTTTAATCCCAAGTAA
AAGAGAAAAGTAGAATAAAATAATCAATCATTTAAATAGTATATTAATTCTATTTCAAGC
TAATCAATATATTCAAATAAATAGTCTTATAATGTAAATTTTATTTAATCTTGGAGACTT
CTTTGGAAAAATAGTCAGTAGCTTTCATTTTTATAGTTCAGTTCTGCTTTATACTTTAAC
TATTTTAAGAGGCATATTTTTCTATACATTTTTGATGTCTGCAAGAGAACCCGATAACTA
ATTCTTTCGAAACGATTATTTTGCTATGGTAGACATTTTTATATTTGGTTTGACACATGG
CTTTGTAGCGAGCGGTCTTATGTAAATAGGAGCAAAAAAAAGTTCTAATCTTGAAGAAAA
AAATATAATTTCATTTATTTTGGCGTTTTTCTTTACATTAGGTTTGTCTGCAGGTACTTT
TTTAGCATTAATTCTAGAAGAACATTGA