Identifiers and Description

Gene Model Identifier

TTHERM_00941430

Standard Name

NTP12 (Nucleoside transporter 12)

Aliases

PreTt25149 | 171.m00058

Description

Nucleoside transporter family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.8%

TetraMine Data

TTHERM_00941430

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19592.19.997093137033517e-262nucleoside transporter (475 aa
)
OxytrichaContig18964.0.g303.999672240330216e-26Nucleoside transporter

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00941430(coding)
ATGGAAAACAACGAAAATCTACTAATGAGGGAAAAAAAAGATTCTAATCAAATATTTAGC
TATGTTTATTTTGTTTTGCAAGGCATAATTTCATTATTAGGGTATAATGCTATCTTAGGT
TCATTAGATTACTTTGCATAAAATTTTAGTGATTATAACATTTACTTTTATCTTCCCTTA
CCTCCTATGATAACATTTAATTTAGTCTCACTTGCTATGCCTTTTATCGCACAGAAAGTT
TTATTCCCTTTAAGAATATCAATTTGCATTTTTGGAATGGTTGTAATCCTAGTAATGCTT
CCTATTGCAACAAACTATTTATCCTAAACAGCTGGAGGCTTTGTAGTGATCATGATTCTT
TCTTTAATTTGGGGTGTTTTTGGTTAGATTTTTAATAGCTCATTGCTTGGATTATCTTGC
ATGATGGACCAAAGTAAAATAGTAGCTTACAATATAGGAAGTAGCGCAAGTGGAATAATA
GTTATCTTAATTAGAATAATTGTTGTTTGTTTTTTAGGCGATGATGTTAATTTTTCTACT
TTGATTTATTTTCTTTCTGCTGGGTTTCTCAACGTAGTAGGTTTTATATTGCATCAATTT
TATGTTAAGACAACGAGCTATATGAGTCTTTAAGAAAAAAACAAATAAAGTTTAATATAT
TAATAAGAAGAATAAATTATTGAAGATTAAAACTATCTTGAAGATAACTCTCCTGAATAA
ATATAAACGGTGAGTACTGCAACTTACTGCAAAACTATTGAAAATCAAAAGAAAAATTAG
AGATTACTAATCTAAAATAATAATGAAAATGATAAAAAAGCACTATCTCATTATTCCCTC
AACGAAAACTAGGATGAAAGTAGTAAAAAATCATTTCATAAACTTAATTTCAGATAATAG
TTTATTCAATATTTACTCATAGCTAAAGATTTAATGCCTTTACCTTTATTTATGCTCTTA
AGCAACGTATGTGCTAATATGATGTACCCAGCTATAAGCTTGAAAAGCTAATTATAAGGA
ATTTCATACACTTGGAGCTGTATATGGATTATTTTCATGCATAATGTATCTAATGTTCTT
GGTAAACATGTAGTAGCAATAAGAAGTCTATACAATAACAACATCATCTATTCACTTATC
ATTCTACGTTTTCTACACTTTATTATATTTATAATGAATGCTGTCAATAGTGATTCAATC
TTCTCTGCAGACTGGATCATTTGTCTAAACATAATTGTTTTTTCTTTCTCTGCAGGATAC
ACAGATAGTGCTCTTTTTATTCTTTCCACTGAAAAAATGATTAGCAATTATCATAGAGAA
TAAGCAGGATTTGTAATGGCTTTTTCTTTAACTTTTGGAATCATGGTAGGAATATTTTTG
GCAATGCCATTTTAAAATATCTGA


>TTHERM_00941430(protein)
MENNENLLMREKKDSNQIFSYVYFVLQGIISLLGYNAILGSLDYFAQNFSDYNIYFYLPL
PPMITFNLVSLAMPFIAQKVLFPLRISICIFGMVVILVMLPIATNYLSQTAGGFVVIMIL
SLIWGVFGQIFNSSLLGLSCMMDQSKIVAYNIGSSASGIIVILIRIIVVCFLGDDVNFST
LIYFLSAGFLNVVGFILHQFYVKTTSYMSLQEKNKQSLIYQQEEQIIEDQNYLEDNSPEQ
IQTVSTATYCKTIENQKKNQRLLIQNNNENDKKALSHYSLNENQDESSKKSFHKLNFRQQ
FIQYLLIAKDLMPLPLFMLLSNVCANMMYPAISLKSQLQGISYTWSCIWIIFMHNVSNVL
GKHVVAIRSLYNNNIIYSLIILRFLHFIIFIMNAVNSDSIFSADWIICLNIIVFSFSAGY
TDSALFILSTEKMISNYHREQAGFVMAFSLTFGIMVGIFLAMPFQNI


>TTHERM_00941430(gene)
ATGGAAAACAACGAAAATCTACTAATGAGGGAAAAAAAAGATTCTAATCAAATATTTAGC
TATGTTTATTTTGTTTTGCAAGGCATAATTTCATTATTAGGGTATAATGCTATCTTAGGT
TCATTAGATTACTTTGCATAAAATTTTAGTGATTATAACATTTACTTTTATCTTCCCTTA
CCTCCTATGATAACATTTAATTTAGTCTCACTTGCTATGCCTTTTATCGCACAGAAAGTT
TTATTCCCTTTAAGAATATCAATTTGCATTTTTGGAATGGTTGTAATCCTAGTAATGCTT
CCTATTGCAACAAACTATTTATCCTAAACAGCTGGAGGCTTTGTAGTGATCATGATTCTT
TCTTTAATTTGGGGTGTTTTTGGTTAGATTTTTAATAGCTCATTGCTTGGATTATCTTGC
ATGATGGACCAAAGTAAAATAGTAGCTTACAATATAGGAAGTAGCGCAAGTGGAATAATA
GTTATCTTAATTAGAATAATTGTTGTTTGTTTTTTAGGCGATGATGTTAATTTTTCTACT
TTGATTTATTTTCTTTCTGCTGGGTTTCTCAACGTAGTAGGTTTTATATTGCATCAATTT
TATGTTAAGACAACGAGCTATATGAGTCTTTAAGAAAAAAACAAATAAAGTTTAATATAT
TAATAAGAAGAATAAATTATTGAAGATTAAAACTATCTTGAAGATAACTCTCCTGAATAA
ATATAAACGGTGAGTACTGCAACTTACTGCAAAACTATTGAAAATCAAAAGAAAAATTAG
AGATTACTAATCTAAAATAATAATGAAAATGATAAAAAAGCACTATCTCATTATTCCCTC
AACGAAAACTAGGATGAAAGTAGTAAAAAATCATTTCATAAACTTAATTTCAGATAATAG
TTTATTCAATATTTACTCATAGCTAAAGATTTAATGCCTTTACCTTTATTTATGCTCTTA
AGCAACGTATGTGCTAATATGATGTACCCAGCTATAAGCTTGAAAAGCTAATTATAAGGA
ATTTCATACACTTGGAGCTGTATATGGATTATTTTCATGCATAATGTATCTAATGTTCTT
GGTAAACATGTAGTAGCAATAAGAAGTCTATACAATAACAACATCATCTATTCACTTATC
ATTCTACGTTTTCTACACTTTATTATATTTATAATGAATGCTGTCAATAGTGATTCAATC
TTCTCTGCAGACTGGATCATTTGTCTAAACATAATTGTTTTTTCTTTCTCTGCAGGATAC
ACAGATAGTGCTCTTTTTATTCTTTCCACTGAAAAAATGATTAGCAATTATCATAGAGAA
TAAGCAGGATTTGTAATGGCTTTTTCTTTAACTTTTGGAATCATGGTAGGAATATTTTTG
GCAATGCCATTTTAAAATATCTGA