Identifiers and Description

Gene Model Identifier

TTHERM_00734080

Standard Name

NTP11 (Nucleoside transporter 11)

Aliases

PreTt25431 | 120.m00089

Description

Nucleoside transporter family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF08627 ) CRT-like
  • ( PF01733 ) Nucleoside transporter
  • ( TIGR00939 ) Nucleoside Transporter
  • ( PF01889 ) Membrane protein of unknown function
  • ( PF07690 ) transporter, major facilitator family
  • ( PF03681 ) Uncharacterised protein family (UPF0150)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00734080

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10613.19.997093137033517e-262nucleoside transporter (494 aa
)
OxytrichaContig18964.0.g301.000382677035467e-28Nucleoside transporter
WormBaseWBGene000081230.00007000107212225429locus:ent-6 status:Confirmed
UniProt:Q9U3L8 protein_id
:CAB62793.2
SGDYAL022C0.00007000107212225429FUN26 Vacuolar membrane transp
orter with broad nucleoside se
lectivity; may regulate balanc
e of nicotinamide riboside (Nm
R) levels between cytosol and
vacuole, contributing to salva
ge of NmR for use in cytosolic
NAD+ synthesis

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00734080(coding)
ATGACCCAAGAAACTTATCCTATTGAAGATGTTTAGGGAAACAAATCTCCCAGAAAGTTG
GAAGACTCTAACTGCAACGCTTAAGTTTACCCAGCTGAAATCCCATTAAAAAAGGTCGAT
TCTGAAATTGATGAAATGTTCAAGCAATTAGAATAAGAATTGGCTAAGCCTCTTCCTCCA
GTCAAGTTTTGGTACAAAATTACCTTCGTCTTTTTAGGTATTGCCTCCTTAGCTGGTTGG
AATGCTATGCTTACTGCATTCGATTTCTTCGGTGCCAAGTATCCCAAAGATTAAGGTTAC
CTCGATATCACTTTCTATTTCCCTATCCCTATTATGATTACCAACTTCTTTGCTGGTCTC
GCCTGTCCTGCTCTTGCCCGTCGTTTCAGCTATAACCAAAGAATTGCTTATCTTTCTGTT
GCTGTCTGCTGTTTCTTAATTACTATCACTTTGATTGCTATCTTTTACAATACTAAGGCT
GGTTTTTGGATTTCCTTCACTCTCCTTTTCTTCTAAGGTTTCATTGAATCAGTTGTTACC
AACTCTCTTATCGCCCTCGCTGGTATGATCTCCCACGAAATCAATGCCATTTACTGGACT
TGCACTGCCGCCTCTGGTTTGGTCATGAACTTCATTAGACTTATTGCCTTAGGCGCTGCT
GGTGATACTCCCTCTTCTATGAACGTCTGCACAGCAATTTACTTCGCCTTCGCTTGTCTT
ATTTATATCGTCTCTGCCTCTATGCAAGCTGCCTTCACCAAAACTGAATACTTTAAGGCT
CTTGAACACAGACACAACATCAAGTCAAAAATTGAAAACAGAGAAATTGAAATAGATATG
GCCAGAATGATGAAGGAAAAGTTGGCTGCTGAAAACAACAATGCTAACACCGGTTCTGAT
AATCAACTTAAAACCGAATAAGCTTTGTCTTAAGTTAATCTTGAACAACAAAAGAAATCA
AAGAAGAGTGGACTCGTTGCCAAGTTGTTACAAAACTCTTTCATTTAATATCTTATCTAT
CTCTCTCAAGTCTTCAAATATGCTGGTGCCATCCCCGTCTTCCTTGTCTTCATCTACATC
TAAACTTTCATGATGTTCCCTGGTGTCTCCATTTTCTAAAAACCCACCTACACTATCATT
CCCTACCCCTACGCAGCAGTTTGGATGATTACTTGTTACAATTTCGGTGATTTGGTTGGC
AAATATCTTGGTAGTGTTAAGGCCTTAGAAAAATTATATTTCATCTACTGTGTTGTCATG
CTCAGATTTGTTTACTATGTCTTATTCTTAATGACTGCTAATGAAAAGGGAGGAGAAAAT
TTCCAAAACGATGTTTTCGCTTGGACTAATTAACTCATGTTCGCTATTACCAACGGTTTC
TGCACTACTGGTTTAATGAACCTTGGTCCCCGTAAATGCAAAGATCCCAAAATTATTAAT
TTAATTAATTTCATTGGTGGTTTCTCTATTACTTTCGGTATTGCTATCGGTACTTTCCTT
GCTCTTCCTCTTGCTAAGGAGTGA


>TTHERM_00734080(protein)
MTQETYPIEDVQGNKSPRKLEDSNCNAQVYPAEIPLKKVDSEIDEMFKQLEQELAKPLPP
VKFWYKITFVFLGIASLAGWNAMLTAFDFFGAKYPKDQGYLDITFYFPIPIMITNFFAGL
ACPALARRFSYNQRIAYLSVAVCCFLITITLIAIFYNTKAGFWISFTLLFFQGFIESVVT
NSLIALAGMISHEINAIYWTCTAASGLVMNFIRLIALGAAGDTPSSMNVCTAIYFAFACL
IYIVSASMQAAFTKTEYFKALEHRHNIKSKIENREIEIDMARMMKEKLAAENNNANTGSD
NQLKTEQALSQVNLEQQKKSKKSGLVAKLLQNSFIQYLIYLSQVFKYAGAIPVFLVFIYI
QTFMMFPGVSIFQKPTYTIIPYPYAAVWMITCYNFGDLVGKYLGSVKALEKLYFIYCVVM
LRFVYYVLFLMTANEKGGENFQNDVFAWTNQLMFAITNGFCTTGLMNLGPRKCKDPKIIN
LINFIGGFSITFGIAIGTFLALPLAKE


>TTHERM_00734080(gene)
ATGACCCAAGAAACTTATCCTATTGAAGATGTTTAGGGAAACAAATCTCCCAGAAAGTTG
GAAGACTCTAACTGCAACGCTTAAGTTTACCCAGCTGAAATCCCATTAAAAAAGGTCGAT
TCTGAAATTGATGAAATGTTCAAGCAATTAGAATAAGAATTGGCTAAGCCTCTTCCTCCA
GTCAAGTTTTGGTACAAAATTACCTTCGTCTTTTTAGGTATTGCCTCCTTAGCTGGTTGG
AATGCTATGCTTACTGCATTCGATTTCTTCGGTGCCAAGTATCCCAAAGATTAAGGTTAC
CTCGATATCACTTTCTATTTCCCTATCCCTATTATGATTACCAACTTCTTTGCTGGTCTC
GCCTGTCCTGCTCTTGCCCGTCGTTTCAGCTATAACCAAAGAATTGCTTATCTTTCTGTT
GCTGTCTGCTGTTTCTTAATTACTATCACTTTGATTGCTATCTTTTACAATACTAAGGCT
GGTTTTTGGATTTCCTTCACTCTCCTTTTCTTCTAAGGTTTCATTGAATCAGTTGTTACC
AACTCTCTTATCGCCCTCGCTGGTATGATCTCCCACGAAATCAATGCCATTTACTGGACT
TGCACTGCCGCCTCTGGTTTGGTCATGAACTTCATTAGACTTATTGCCTTAGGCGCTGCT
GGTGATACTCCCTCTTCTATGAACGTCTGCACAGCAATTTACTTCGCCTTCGCTTGTCTT
ATTTATATCGTCTCTGCCTCTATGCAAGCTGCCTTCACCAAAACTGAATACTTTAAGGCT
CTTGAACACAGACACAACATCAAGTCAAAAATTGAAAACAGAGAAATTGAAATAGATATG
GCCAGAATGATGAAGGAAAAGTTGGCTGCTGAAAACAACAATGCTAACACCGGTTCTGAT
AATCAACTTAAAACCGAATAAGCTTTGTCTTAAGTTAATCTTGAACAACAAAAGAAATCA
AAGAAGAGTGGACTCGTTGCCAAGTTGTTACAAAACTCTTTCATTTAATATCTTATCTAT
CTCTCTCAAGTCTTCAAATATGCTGGTGCCATCCCCGTCTTCCTTGTCTTCATCTACATC
TAAACTTTCATGATGTTCCCTGGTGTCTCCATTTTCTAAAAACCCACCTACACTATCATT
CCCTACCCCTACGCAGCGTAATAAATTTATTTTTAATTAAACATTTACATTTTTTCATTT
CCTTTTAAAAATTTAGAATCTTTTTTACTAAATTTTAATTTAATTAAAAAATAGAGTTTG
GATGATTACTTGTTACAATTTCGGTGATTTGGTTGGCAAATATCTTGGTAGTGTTAAGGC
CTTAGAAAAATTATATTTCATCTACTGTGTTGTCATGCTCAGATTTGTTTACTATGTCTT
ATTCTTAATGACTGCTAATGAAAAGGGAGGAGAAAATTTCCAAAACGATGTTTTCGCTTG
GACTAATTAACTCATGTTCGCTATTACCAACGGTTTCTGCACTACTGGTTTAATGAACCT
TGGTCCCCGTAAATGCAAAGATCCCAAAATTATTAATTTAATTAATTTCATTGGTGGTTT
CTCTATTACTTTCGGTATTGCTATCGGTACTTTCCTTGCTCTTCCTCTTGCTAAGGAGTG
A