Identifiers and Description

Gene Model Identifier

TTHERM_00155440

Standard Name

NTP10 (Nucleoside transporter 10)

Aliases

PreTt28334 | 13.m00293 | 3829.m01142

Description

Nucleoside transporter family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF01733 ) Nucleoside transporter
  • ( TIGR00939 ) Nucleoside Transporter
  • ( PF07690 ) transporter, major facilitator family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00155440

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05228.19.997093137033517e-262nucleoside transporter (503 aa
)
OxytrichaContig18964.0.g308.00344477495519e-22Nucleoside transporter
DictyBaseDDB_G02815150.0000000000499999055251093DDB_G0281515 on chromosome: 3
position 4654406 to 4656214
SGDYAL022C0.00000000039982266684865623FUN26 Vacuolar membrane transp
orter with broad nucleoside se
lectivity; may regulate balanc
e of nicotinamide riboside (Nm
R) levels between cytosol and
vacuole, contributing to salva
ge of NmR for use in cytosolic
NAD+ synthesis

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00155440(coding)
ATGTTATAAAAACAGGTTTCCTAAAACGATTAGTACTAGCAGCCTGACAACAAGTTGCCC
CGCTCTTCTCTTTTTGAGCTTCAAACCCTAGGTTAAGGAACAGAAAACGATTTAAATAAT
CTCTAGTTGAAGCAAGGATCTTAATCGAAGGACTCACTCTCTTCACAAACTGTGTTAGAA
AAGTAATAATAAGTAGAAGAAATTACAAAGCAAATTGAACAAACATACGATGTTCTCCCT
CCTGTCAATAATTTCTTAAAATTCTGTTTCATGATGTTCGGTATTTTAGCCTTCGCAGGA
TGGAACGCTGTTATTACTGCTTTTGATTACTTTTCTGTACGTTATCCTAAAGAAGAAATT
CCAGATGTCACATTTTATTTCCCATTTGGTGTTATGATTGGTGATATAATAAGTGGTGTT
ACATTCGTTGCTTAAGCTAAGTATTTTTCAGTTAAATCTAGATTTATGTATACAGTAGTT
ATTGAAGTTATAGTTATTATTAGTCTTTGCATTGTTGCTATGTACTATAATAATATGAGT
GGCTTCTGGATTTCTATGTTCTTATTGTTTATTGATGGTTGGGCTGATAATGTAAAAACC
AATACATTTGTCGTTATAGCAGGTAGTGTTCACCCACAATTAAATAACCTTTTCTGGACA
TACACTGCTTTCTCTGGTTTAATTATGAATGCTTTGAGATTTATAGTCTTGGCAATATTT
GGTGATGACCTTGATAGTAATGCAAATTACGGTACTTTGATATATTTCTGTACTTGTGCA
GTTATCTTTATCATTACAATCATTTGCTTTGCTATTTTTATTAAGTCAAATTACTACAAA
ATATCTTTAAAAATTGATTCCTTGAAGCAACAAAAGATCAAACTCGAAGAAGAATTGTAC
TTTATTAAAAATCAAGACTAGCAAAGATAAAATAATGTTGAGCTCTAAGGATTTTCTAAA
ATATTCTGGGGTGCTTTCAACTATTTAAAAGAATTTATTTTTATCACTAAACACACAGGT
TTTCTCTCATTCTATCTTTTCCTCTCATTCTTCGAAACCTTCTTACTTTTCCCAGGAGTT
TGTGTTTTCAGGAAACCTCAATTCACTTTCTTAGAATTTGCTTGGGCTGCATAAGTTATG
ATGACAGCTTTTAACCTTGGAGATTTTATTGGGAAATATATAGGTTACATTAAATGTTTG
CACCGTCTCTATTGGATTTATGGACTGGTTATTCTTAGAATTTCTTTCATACCAGTTTTT
ATCTTAATGGCAAAAGACGAAGGTAGTGCAGTCTTGCAAGATGACTATTTTATTATGTGC
ATGATTTTCCTATTTTCAATTACTAACGGTTTTATTACTACAAGTCTTGCTCACTTGTCT
CCTAGAAAAATTACAGATCCTTATATTAGAGATAAAGTAAACTTTTTCAGTAACTTTACC
ATGACCTTGGGTATTGATCTTGGTATTGTTTTGGCAATATTCTTAGGTAATGCTCTACCT
ACCTATGGTTGA


>TTHERM_00155440(protein)
MLQKQVSQNDQYQQPDNKLPRSSLFELQTLGQGTENDLNNLQLKQGSQSKDSLSSQTVLE
KQQQVEEITKQIEQTYDVLPPVNNFLKFCFMMFGILAFAGWNAVITAFDYFSVRYPKEEI
PDVTFYFPFGVMIGDIISGVTFVAQAKYFSVKSRFMYTVVIEVIVIISLCIVAMYYNNMS
GFWISMFLLFIDGWADNVKTNTFVVIAGSVHPQLNNLFWTYTAFSGLIMNALRFIVLAIF
GDDLDSNANYGTLIYFCTCAVIFIITIICFAIFIKSNYYKISLKIDSLKQQKIKLEEELY
FIKNQDQQRQNNVELQGFSKIFWGAFNYLKEFIFITKHTGFLSFYLFLSFFETFLLFPGV
CVFRKPQFTFLEFAWAAQVMMTAFNLGDFIGKYIGYIKCLHRLYWIYGLVILRISFIPVF
ILMAKDEGSAVLQDDYFIMCMIFLFSITNGFITTSLAHLSPRKITDPYIRDKVNFFSNFT
MTLGIDLGIVLAIFLGNALPTYG


>TTHERM_00155440(gene)
ATGTTATAAAAACAGGTTTCCTAAAACGATTAGTACTAGCAGCCTGACAACAAGTTGCCC
CGCTCTTCTCTTTTTGAGCTTCAAACCCTAGGTTAAGGAACAGAAAACGATTTAAATAAT
CTCTAGTTGAAGCAAGGATCTTAATCGAAGGACTCACTCTCTTCACAAACTGTGTTAGAA
AAGTAATAATAAGTAGAAGAAATTACAAAGCAAATTGAACAAACATACGATGTTCTCCCT
CCTGTCAATAATTTCTTAAAATTCTGTTTCATGATGTTCGGTATTTTAGCCTTCGCAGGA
TGGAACGCTGTTATTACTGCTTTTGATTACTTTTCTGTACGTTATCCTAAAGAAGAAATT
CCAGATGTCACATTTTATTTCCCATTTGGTGTTATGATTGGTGATATAATAAGTGGTGTT
ACATTCGTTGCTTAAGCTAAGTATTTTTCAGTTAAATCTAGATTTATGTATACAGTAGTT
ATTGAAGTTATAGTTATTATTAGTCTTTGCATTGTTGCTATGTACTATAATAATATGAGT
GGCTTCTGGATTTCTATGTTCTTATTGTTTATTGATGGTTGGGCTGATAATGTAAAAACC
AATACATTTGTCGTTATAGCAGGTAGTGTTCACCCACAATTAAATAACCTTTTCTGGACA
TACACTGCTTTCTCTGGTTTAATTATGAATGCTTTGAGATTTATAGTCTTGGCAATATTT
GGTGATGACCTTGATAGTAATGCAAATTACGGTACTTTGATATATTTCTGTACTTGTGCA
GTTATCTTTATCATTACAATCATTTGCTTTGCTATTTTTATTAAGTCAAATTACTACAAA
ATATCTTTAAAAATTGATTCCTTGAAGCAACAAAAGATCAAACTCGAAGAAGAATTGTAC
TTTATTAAAAATCAAGACTAGCAAAGATAAAATAATGTTGAGCTCTAAGGATTTTCTAAA
ATATTCTGGGGTGCTTTCAACTATTTAAAAGAATTTATTTTTATCACTAAACACACAGGT
TTTCTCTCATTCTATCTTTTCCTCTCATTCTTCGAAACCTTCTTACTTTTCCCAGGAGTT
TGTGTTTTCAGGAAACCTCAATTCACTTTCTTAGAATTTGCTTGGGCTGCGTAAAATTTT
ACTTTAACTTTTATTTTTTTTTTTGCTTATTCCCCAGCTTTTTTGAAGATTTACAAATAA
AAAATATAATGAATGATTTCTGTAAAATTAAGATTTTTTAGATACAAATTTTTTTAAATC
TTAAAACATGTAAATTATTTATATCTAATTAGCTTATTACTTACTCTAAAGTAAAGCATA
TAAAAGAATTTTTAATTTTAAAGTAAATTAATCTATACAATTACAATCTATCTTTCAAAA
TGCAAAGGAAAATTAGTTCTATTGACAAAATTTTTTAAAATATAAAATTCTATTTTAAAA
AAAATCTAATTAAAGTTGGTTAAAACGTTTTTGAAAATTGCAAATAATAATTTAAACTAA
TCATTTTAATTAACTTAAATAGATAAGTTATGATGACAGCTTTTAACCTTGGAGATTTTA
TTGGGAAATATATAGGTTACATTAAATGTTTGCACCGTCTCTATTGGATTTATGGACTGG
TTATTCTTAGAATTTCTTTCATACCAGTTTTTATCTTAATGGCAAAAGACGAAGGTAGTG
CAGTCTTGCAAGATGACTATTTTATTATGTGCATGATTTTCCTATTTTCAATTACTAACG
GTTTTATTACTACAAGTCTTGCTCACTTGTCTCCTAGAAAAATTACAGATCCTTATATTA
GAGATAAAGTAAACTTTTTCAGTAACTTTACCATGACCTTGGGTATTGATCTTGGTATTG
TTTTGGCAATATTCTTAGGTAATGCTCTACCTACCTATGGTTGA