Identifiers and Description

Gene Model Identifier

TTHERM_01106120

Standard Name

NTG1 (eNdonuclease Three-like Glycosylase)

Aliases

PreTt04526 | 236.m00030 | 3800.m00152

Description

HhH-GPD superfamily base excision DNA repair protein; similar to yeast NTG1, a DNA N-glycosylase and apurinic/apyrimidinic (AP) lyase involved in base excision repair; contains an endonuclease C3 domain and an Fe-sulfur binding domain

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_01106120

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20657.11.999807452113044e-171HhH-GPD superfamily base excis
ion DNA repair protein (376 aa
)
DictyBaseDDB_G02772477.000176714425793e-58apnB on chromosome: 2 position
7816486 to 7817535
WormBaseWBGene000112019.997652352281279e-57locus:nth-1 Probable endonuc
lease III homolog status:Con
firmed UniProt:P54137 prot
ein_id:CBK55598.1
OxytrichaContig9879.0.0.g141.9992362000979228e-56HhH-GPD superfamily base excis
ion DNA repair protein
SGDYAL015C4.001416569413617e-37NTG1 DNA N-glycosylase and apu
rinic/apyrimidinic (AP) lyase
involved in base excision repa
ir; acts in both nucleus and m
itochondrion; creates a double
-strand break at mtDNA origins
that stimulates replication i
n response to oxidative stress
Stentor CoeruleusSteCoe_296301.185064864233981e-27

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01106120(coding)
ATGCCTCCAAAACAATAAAAAACCAAAAAAAATAAAAAAGCTGTTGATTTGCCAGAAAAT
GATAAAGATAAAGAAGAAATACTCGAGAATATTAAGATTACAGAATAAAATGATGAATTA
AAATCTGAAATAGATAGCTTGGATTAATTTAAATTTTAAAAAGAAGAAGTGAACAATCCC
ATTAAAAAAACAAGAAAGCAAAAATTATAAATAGAATATGAATAAAGTGTTAATAAAGTT
GAAAGAGCTTCCAGAAAAAAATTATTAGATAAAAACATTGATGAAGATGATAAAAATTAA
AAATAGCAAACAAATAATTAATTAGACAATTAAAATGGCAATGAAGAGAAAAGTGAATAA
GTAAAAAATTAATCTGAAGAAAATAATAATTAGAATGAATAAAAGAAAAAGGGAAAGTAT
AATTGTAGAGAAAATTATGAAGAAATTTACAGTTTAATAAAAGGATATAGAGATACTCAT
ACAGCTCCAGTAGATACTTTAGGATGTGATCTCTAAGGGGATGAATCTTTACCAACAAAT
GATAGAAATTTTTAAAAATTAATGGCAATTATATTGAGTGTATAGACAAAAGATGAAACA
ACTGACCTAGTAATGAAGAAAGTAGTAAAAGAGAAAATAACTATTGATAAAGCCGTTGAA
ATTCCATCGAGCGAATTAAAAGAAATAATTAAATAAGTTAACTTTAATGGAAAAAAAGTA
GAATATATTAAGAACGCAGCAGAAGTTATAAAAAATACATATAACTATGTTATACCTGAT
TAGTATGAAGATTTAATTAAAATCAAGGGAATAGGTCCAAAAGTTGCAAATTTATTTTTG
TAATGTGCATATAATAAAACTGTAGGAATAGCTGTAGACACGCATGTTCATAGAATATCT
AATAGGCTTGAATGGGTTTCAACAAAAACTCCTGAATAAACTCGAATTGAATTAGAAAAA
TTGCTTGATAAAAAGTATTGGGAAGATGTAAACAATCTGTTAGTTGGATATGGTTAATCA
GTTTGTAAGCCTTAAAATCCCTAGTGCTAAATATGTCCTGTAAAAGATAAGTGTCCTGAG
GGTAGAAGAAGATTAAAAGGAAAGAAAAAAATATGA


>TTHERM_01106120(protein)
MPPKQQKTKKNKKAVDLPENDKDKEEILENIKITEQNDELKSEIDSLDQFKFQKEEVNNP
IKKTRKQKLQIEYEQSVNKVERASRKKLLDKNIDEDDKNQKQQTNNQLDNQNGNEEKSEQ
VKNQSEENNNQNEQKKKGKYNCRENYEEIYSLIKGYRDTHTAPVDTLGCDLQGDESLPTN
DRNFQKLMAIILSVQTKDETTDLVMKKVVKEKITIDKAVEIPSSELKEIIKQVNFNGKKV
EYIKNAAEVIKNTYNYVIPDQYEDLIKIKGIGPKVANLFLQCAYNKTVGIAVDTHVHRIS
NRLEWVSTKTPEQTRIELEKLLDKKYWEDVNNLLVGYGQSVCKPQNPQCQICPVKDKCPE
GRRRLKGKKKI


>TTHERM_01106120(gene)
ATGCCTCCAAAACAATAAAAAACCAAAAAAAATAAAAAAGCTGTTGATTTGCCAGAAAAT
GATAAAGATAAAGAAGAAATACTCGAGAATATTAAGATTACAGAATAAAATGATGAATTA
AAATCTGAAATAGATAGCTTGGATTAATTTAAATTTTAAAAAGAAGAAGTGAACAATCCC
ATTAAAAAAACAAGAAAGCAAAAATTATAAATAGAATATGAATAAAGTGTTAATAAAGTT
GAAAGAGCTTCCAGAAAAAAATTATTAGATAAAAACATTGATGAAGATGATAAAAATTAA
AAATAGCAAACAAATAATTAATTAGACAATTAAAATGGCAATGAAGAGAAAAGTGAATAA
GTAAAAAATTAATCTGAAGAAAATAATAATTAGAATGAATAAAAGAAAAAGGGAAAGTAT
AATTGTAGAGAAAATTATGAAGAAATTTACAGTTTAATAAAAGGATATAGAGATACTCAT
ACAGCTCCAGTAGATACTTTAGGATGTGATCTCTAAGGGGATGAATCTTTACCAACAAAT
GATAGAAATTTTTAAAAATTAATGGCAATTATATTGAGTGTATAGACAAAAGATGAAACA
ACTGACCTAGTAATGAAGAAAGTAGTAAAAGAGAAAATAACTATTGATAAAGCCGTTGAA
ATTCCATCGAGCGAATTAAAAGAAATAATTAAATAAGTTAACTTTAATGGAAAAAAAGTA
GAATATATTAAGAACGCAGCAGAAGTTATAAAAAATACATATAACTATGTTATACCTGAT
TAGTATGAAGATTTAATTAAAATCAAGGGAATAGGTCCAAAAGTTGCAAATTTATTTTTG
TAATGTGCATATAATAAAACTGTAGGAATAGCTGTAGACACGCATGTTCATAGAATATCT
AATAGGCTTGAATGGGTTTCAACAAAAACTCCTGAATAAACTCGAATTGAATTAGAAAAA
TTGCTTGATAAAAAGTATTGGGAAGATGTAAACAATCTGTTAGTTGGATATGGTTAATCA
GTTTGTAAGCCTTAAAATCCCTAGTGCTAAATATGTCCTGTAAAAGATAAGTGTCCTGAG
GGTAGAAGAAGATTAAAAGGAAAGAAAAAAATATGA