Identifiers and Description

Gene Model Identifier

TTHERM_00691890

Standard Name

NRS1 (asparaginyl-tRNA synthetase 1)

Aliases

PreTt03027 | 106.m00167 | 3674.m00080

Description

asparaginyl-tRNA synthetase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF03561 ) Allantoicase repeat
  • ( TIGR00499 ) lysyl-tRNA synthetase
  • ( TIGR00458 ) aspartyl-tRNA synthetase
  • ( TIGR00459 ) aspartyl-tRNA synthetase
  • ( TIGR00457 ) asparaginyl-tRNA synthetase
  • ( PF01336 ) OB-fold nucleic acid binding domain
  • ( PF00152 ) tRNA synthetases class II (D,
  • ( TIGR00462 ) lysyl-tRNA synthetase-like protein GenX
  • ( TIGR00161 ) conserved hypothetical protein TIGR00161
  • ( PF00587 ) tRNA synthetase class II core

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00691890

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_66600
Tetrahymena borealisEI9_17553.19.997093137033517e-262asparaginyl-tRNA synthetase (6
12 aa)
DictyBaseDDB_G02681001.9999788875029746e-125asnS2 on chromosome: 1 positio
n 1453036 to 1454418
OxytrichaContig16275.0.g394.9988663627895604e-120tRNA synthetases class II (D,
K and N)
SGDYCR024C1.9996609186508915e-82SLM5 Mitochondrial asparaginyl
-tRNA synthetase
WormBaseWBGene000134475.997098480211051e-62locus:nars-2 status:Confirme
d UniProt:Q95PZ8 protein_i
d:CAC70140.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00691890(coding)
ATGGAAGAAGGTACATATTTCTTAAATTCAGACGAAATGAGAAACACCCTTTTATTTAAA
TATTTCTGTACAGTTGCTAAGACTGCCGTAAACACAGCCAAAGAAGTTAGTGAAGTCAAG
CCTGTCAAGGAGACCAAGCCTGCTAAAGAACCTAAAGCTCCCAAAGAACAAAAACCAAAG
GAAGCAAAAGAATAAAAGGAAACTAAAGCCCCAGTTGTTGAAGAAAAGCCCTTCACTTAT
GATTTTACTGAAGACTTAAAGCTCGTCAACCACAGTTTCGAAAAGGTTAGATTAAACCCT
ACCACTTCATATGTCGTCCCTCCTGAATTAATGAACAAGCCTTCAAGTTAATATTTGGTT
GGTTCTGTTGAAAAAATCTCTAACATTCTTATTGATCCTGAAAACTACATTGGAAAAGTA
GGAACTGTTGCTGGTTGGGCTAGAACTACTAGAGCTGCTGGTAAGGATCTTTTCTTCATC
GAATTGAACGACGGTACTTGCTAAAAGGGTATTCAAATCGTCGTAAGTAGTGGTACTATT
GAAAACTACGATACTGTCGTCAAGATTAATACTGCAACTTCAGTGAAGGTCACTGGTCTT
TTCGTCAAGCCTGAAGGTGGTAGCGAAAAGGTTGAAGTCAAGATTGGATCTGCTGAACAC
AAGGTTGAAATTTTGGGTGCTATTGATCCTGCTCTCTCTAAGACTTACCCTATGGCTAAA
AAGTTCCACACTGTCGAAAAGTTAAGAGAAATTGCTCACTTACGTCCTCGTTCTAACTTA
ATTGGTTGTGTTGCAAGAATTAGAAACAATCTTGCTTATGCTACTCACATCTACTTCCAA
TCTAACGGTTTCCAATACATTCACACCCCTCTTATTACTGCATCTGATTGCGAAGGAGCT
GGTGAAATGTTCTAAGTTACTACAACTTTACCCAAGCCTGAAGAATCTCTCCTCAAAGTT
AAGGATAAGGTTCTTGATAAGGAAGGTAGAATCGATTACTCTAAGGATTTCTTCAAGAAG
CCTGCCTTCTTAACTGTCTCTGGTTAACTTTCTGTCGAAAACTACTGCTGCGCCCTTTCC
AACGTCTATACTTTTGGTCCTACCTTTAGAGCTGAAGTTTCTCACACTACTCGTCACTTG
GCTGAATTCTGGATGATCGAACCCGAATTAGCTTTCGCTGATGTTCACGATGTTATGGAT
TGTGCTGAAGGTTACGTTAAGTTCTGTCTTGAATATGTCTTAACTAACAACAAATCCGAT
CTTGAATTCCTTCAAAATGCTTTGAAAAAGCCTGAACTTGTTGAATATCTTAAGGGTTTG
ATCAGCGGTCCCTTCGCTAGATTGAGCTACACTGATGCCATCACTCTTCTCTAAAAGGCT
GTTGCTAACGGAAAGGTCTTTGAAAACAAGGTTGAATGGGGTGAGGAATTAGCTACTGAA
CACGAACGTTTCCTCGCTGAAGTAGTTTTCAAGAAGCCTGTTGCCGTATATAACTATCCT
AAGGGATTCAAGGCCTTCTACATGAGATTAAACGAAGATGGCAAGACTGTCGCTGCCTTC
GATATGTTGGCTCCTTAAGTAGGTGAATTAATTGGAGGATCTCAAAGAGAAGAAAGATTA
GATGTCTTAGAAAAGAGAATGATTGAATCTGGCTTAAACCCTGCTGATTACTGGTGGTAT
TTGGACTTAAGAAGATACGGTACTGTTCCTCATGGTGGTTTTGGTTTAGGTTTCGAAAGA
CTTTGCATGTTATGTTCTGGTGTTGACAACGTTAGAGACGTTATTCCTTTCCCCAGAACT
CACGGTAACGCTGAATTTTGA


>TTHERM_00691890(protein)
MEEGTYFLNSDEMRNTLLFKYFCTVAKTAVNTAKEVSEVKPVKETKPAKEPKAPKEQKPK
EAKEQKETKAPVVEEKPFTYDFTEDLKLVNHSFEKVRLNPTTSYVVPPELMNKPSSQYLV
GSVEKISNILIDPENYIGKVGTVAGWARTTRAAGKDLFFIELNDGTCQKGIQIVVSSGTI
ENYDTVVKINTATSVKVTGLFVKPEGGSEKVEVKIGSAEHKVEILGAIDPALSKTYPMAK
KFHTVEKLREIAHLRPRSNLIGCVARIRNNLAYATHIYFQSNGFQYIHTPLITASDCEGA
GEMFQVTTTLPKPEESLLKVKDKVLDKEGRIDYSKDFFKKPAFLTVSGQLSVENYCCALS
NVYTFGPTFRAEVSHTTRHLAEFWMIEPELAFADVHDVMDCAEGYVKFCLEYVLTNNKSD
LEFLQNALKKPELVEYLKGLISGPFARLSYTDAITLLQKAVANGKVFENKVEWGEELATE
HERFLAEVVFKKPVAVYNYPKGFKAFYMRLNEDGKTVAAFDMLAPQVGELIGGSQREERL
DVLEKRMIESGLNPADYWWYLDLRRYGTVPHGGFGLGFERLCMLCSGVDNVRDVIPFPRT
HGNAEF


>TTHERM_00691890(gene)
ATGGAAGAAGGTACATATTTCTTAAATTCAGACGAAATGAGAAACACCCTTTTATTTAAA
TATTTCTGTACAGTTGCTAAGACTGCCGTAAACACAGCCAAAGAAGTTAGTGAAGTCAAG
CCTGTCAAGGAGACCAAGCCTGCTAAAGAACCTAAAGCTCCCAAAGAACAAAAACCAAAG
GAAGCAAAAGAATAAAAGGAAACTAAAGCCCCAGTTGTTGAAGAAAAGCCCTTCACTTAT
GATTTTACTGAAGACTTAAAGCTCGTCAACCACAGTTTCGAAAAGGTTAGATTAAACCCT
ACCACTTCATATGTCGTCCCTCCTGAATTAATGAACAAGCCTTCAAGTTAATATTTGGTT
GGTTCTGTTGAAAAAATCTCTAACATTCTTATTGATCCTGAAAACTACATTGGAAAAGTA
GGAACTGTTGCTGGTTGGGCTAGAACTACTAGGTAACAAACACACTCATACTTTTTATTT
TATTTTTTAGCAAAAAAAGCATAAGGAAAGAATAAGCATAGCACATTTATTTAGAATCTA
TTAAAAAATTAGAGCGAATTCAAATTAAGTTTAAATTTTATTAAATAGAGCTGCTGGTAA
GGATCTTTTCTTCATCGAATTGAACGACGGTACTTGCTAAAAGGGTATTCAAGTATGGAG
CAATTTTATTAAAACGATTTACTCTTTAGTTTCAATTGAAAATTTGATAATTTTAAATAA
TTTACCTTTAAAATAAATAGATCGTCGTAAGTAGTGGTACTATTGAAAACTACGATACTG
TCGTCAAGATTAATACTGCAACTTCAGTGAAGGTCACTGGTCTTTTCGTCAAGCCTGAAG
GTGGTAGCGAAAAGGTTGAAGTCAAGATTGGATCTGCTGAACACAAGGTTGAAATTTTGG
GTGCTATTGATCCTGCTCTCTCTAAGACTTACCCTATGGCTAAAAAGTTCCACACTGTCG
AAAAGTTAAGAGAAATTGCTCACTTACGTCCTCGTTCTAACTTAATTGGTTGTGTTGCAA
GAATTAGAAACAATCTTGCTTATGCTACTCACATCTACTTCCAATCTAACGGTTTCCAAT
ACATTCACACCCCTCTTATTACTGCATCTGATTGCGAAGGAGCTGGTAAATAACTTTTGA
ATACTTATCATATATATAAATCTCAATAGATATTCTAGATGCAATTGATTAGTTTTAATA
GTTAGTTGGTTTGATATATAATTTAAAAGAAGAATTAGATATTTTTCCTCTGTTTTTAGT
TTTCCTTTACATATATTTTCAAAAATAAATTACATAAATATCTAGTTTTTTATTGAACTA
AAAAAATATAACTCAAATTTCGTTAATATCTTTAAAAAAATGTCTATTTAATAAAATAAT
AGGTGAAATGTTCTAAGTTACTACAACTTTACCCAAGCCTGAAGAATCTCTCCTCAAAGT
TAAGGATAAGGTTCTTGATAAGGAAGGTAGAATCGATTACTCTAAGGATTTCTTCAAGAA
GCCTGCCTTCTTAACTGTCTCTGGTTAACTTTCTGTCGAAAACTACTGCTGCGCCCTTTC
CAACGTCTATACTTTTGGTCCTACCTTTAGAGCTGAAGTTTCTCACACTACTCGTCACTT
GGCTGAATTCTGGATGATCGAACCCGAATTAGGTAATTAAAAATAAAATATTTTTCTAAA
ATAATAAAAAAAGTTAGGAAATTTTGAAAGCAAAAAAAATAAATATATAAAGATTAGCAA
GAAATGAGCAAATATTTTAGCTTTATTATTATAAAAGAATAGTAATCAAATAAATAAACT
AATTAATTTTATTTTATCAAATAAAATTTTAGCTTTCGCTGATGTTCACGATGTTATGGA
TTGTGCTGAAGGTTACGTTAAGTTCTGTCTTGAATATGTCTTAACTAACAACAAATCCGA
TCTTGAATTCCTTCAAAATGCTTTGAAAAAGCCTGAACTTGTTGAATATCTTAAGGGTTT
GATCAGCGGTCCCTTCGCTAGATTGAGCTACACTGATGCCATCACTCTTCTCTAAAAGGT
AACAAATAATTCAATAAAATAGTTTATATTAATTGTAATTATATTAAAAAGGCTGTTGCT
AACGGAAAGGTCTTTGAAAACAAGGTTGAATGGGGTGAGGAATTAGCTACTGAACACGAA
CGTTTCCTCGCTGAAGTAGTTTTCAAGAAGCCTGTTGCCGTATATAACTATCCTAAGGGA
TTCAAGGCCTTCTACATGAGATTAAACGAAGATGGCAAGACTGTCGCTGCCTTCGATATG
TTGGCTCCTTAAGTAGGTGAATTAATTGGAGGATCTCAAAGAGAAGAAAGATTAGATGTC
TTAGAAAAGAGAATGATTGAATCTGGCTTAAACCCTGCTGATTACTGGTGGTATTTGGAC
TTAAGAAGATACGGTACTGTTCCTCATGGTGGTTTTGGTTTAGGTTTCGAAAGACTTTGC
ATGTTATGTTCTGGTGTTGACAACGTTAGAGACGTTATTCCTTTCCCCAGAACTCACGGT
AACGCTGAATTTTGA