Identifiers and Description

Gene Model Identifier

TTHERM_01014770

Standard Name

NRP1 (N1/N2-related protein)

Aliases

PreTt04607 | 197.m00081 | 3748.m00317

Description

NRP1; N1/N2-NASP-related protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_01014770

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20230.19.997093137033517e-262hypothetical protein (518 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:34086947: Nabeel-Shah S, Garg J, Saettone A, Ashraf K, Lee H, Wahab S, Ahmed N, Fine J, Derynck J, Pu S, Ponce M, Marcon E, Zhang Z, Greenblatt JF, Pearlman RE, Lambert JP, Fillingham J (2021) Functional characterization of RebL1 highlights the evolutionary conservation of oncogenic activities of the RBBP4/7 orthologue in Tetrahymena thermophila. Nucleic acids research ( ):
  2. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88
  3. Ref:24120531: Garg J, Lambert JP, Karsou A, Marquez S, Nabeel-Shah S, Bertucci V, Retnasothie DV, Radovani E, Pawson T, Gingras AC, Pearlman RE, Fillingham JS (2013) Conserved Asf1-importin ? physical interaction in growth and sexual development in the ciliate Tetrahymena thermophila. Journal of proteomics 94( ):311-26

Sequences

>TTHERM_01014770(coding)
ATGAGTTCTGACAATAGTGAATAAGAAAAATAAATGTAAGAAGAAATAACAAAGGAACAA
AAAATTTTAGATAAGGAAGAAAATGGAGATTAAAATAATCTAAATGATGAAGGCAGTCGT
AACTAGGAAGAGGCTGAGGAAATCACAAAGATATTGAAAGAAAGTTCAAGCAAAGTAAGT
GAAAAGTATTTAGAGAGCAGGCTTACAGAGGCTGTTGAATGTTACAAGAATAAAAACTTT
GATTAGGCTGAAAATATTTTCTCTGATCTGATGATTTATGCAGTTAAATTTTATAAATCT
GAAACCCATGTGAAGATGTCTAAATACTTCTTTTTTTACGGAGATATGCTTCTTTCTAAA
CTTGAAAATAATCCAGATGTCTTTGGAGATAAAGCTTAAAAAAAATTAGACAATTAAACT
ACTGAAGAAGTTGAAAAAAATCCTAATTAAATGGCATCTGAAGAAGCTAGTGAATAGAAA
ATGGTTGCTTAAAAAGAATAAAAAGAGGAGGATGAAGAAGAAAACGAAGAATCTTAGTCC
TAAGGAGAAGAAGAAATTGTTTAGCTAGACACAGTTATTTTTAAAGATGAAAATGTAGAA
ATTAGAGATGAAACTAATGCACCATAAAATAATGAAGAAAATTAAACTGAAGAAAACAAT
CTACCAATTGGTAAAGTGACTATGGAAAAGTCAGATCCTATTGATGATTTATAGTTAGCT
TGGGAAAATTTGGAATTAAGTCGTAAGATTTATAATTAAGAGTTGTTATAATTATAAGAT
AGCTAAGATGAGGATAGAAAAGAAAAATAAATTTAAGTCAAAAAATAAATAGTCGAAGTA
ACTTTAAGAATTGCTGATTTAGAATAATGGAGGGATAATTTCTCAGATGCTTTAAAGGAA
TACACTATGGCTCTTTAGTTGTCAAAAGAAATAGAAGATAGGGAGTATAGCAGAACTTTG
AGCAGTATTTTCTTTTAATTAGGAAACGCTGTACTTTATGAAAATAAAGAATATTGTGAA
GAAGAGGGTCTTAAAAATTTTATTGACAGTGCATAAATATTAGAAAATTGTCTTTCAAAA
AAAATAGCAATTCCTCCTTAAGAACTTCCTAGCTTCAAAATATTAAAAAAAGACGATATT
AAAGTCGACCATTTAAAACACAGCTTTTTGGATGATGATGAATCAAAGGAAATTAAAGAT
ACTCTAAAAGTTTTATATGAAAAAATTGAAGACACCTTGATACAAAGGGATGAAAGAGAT
AAGTACAAAGCTTACTAAGAACTTATGAAAAAATAATCTCAAAATTAAAATCAATTTGCC
TAACCTTCATAAAATAGTGTTCCTATCAAAAATTTAGGTACATTTGGATCCTTAAAAAGA
AAAGAACCTTCTTCTGAAAACAGCAATTCTTAAAATGGTTCTTCAACTACTATGAATATC
CCACCTTAAGAATCAGGTAATAGTCAACAATCATCTAATGGTTCTCATATTAGTCCTGAT
GGAAACCCAGATAAAATGCTCAAAAAGGATTGA


>TTHERM_01014770(protein)
MSSDNSEQEKQMQEEITKEQKILDKEENGDQNNLNDEGSRNQEEAEEITKILKESSSKVS
EKYLESRLTEAVECYKNKNFDQAENIFSDLMIYAVKFYKSETHVKMSKYFFFYGDMLLSK
LENNPDVFGDKAQKKLDNQTTEEVEKNPNQMASEEASEQKMVAQKEQKEEDEEENEESQS
QGEEEIVQLDTVIFKDENVEIRDETNAPQNNEENQTEENNLPIGKVTMEKSDPIDDLQLA
WENLELSRKIYNQELLQLQDSQDEDRKEKQIQVKKQIVEVTLRIADLEQWRDNFSDALKE
YTMALQLSKEIEDREYSRTLSSIFFQLGNAVLYENKEYCEEEGLKNFIDSAQILENCLSK
KIAIPPQELPSFKILKKDDIKVDHLKHSFLDDDESKEIKDTLKVLYEKIEDTLIQRDERD
KYKAYQELMKKQSQNQNQFAQPSQNSVPIKNLGTFGSLKRKEPSSENSNSQNGSSTTMNI
PPQESGNSQQSSNGSHISPDGNPDKMLKKD


>TTHERM_01014770(gene)
ATGAGTTCTGACAATAGTGAATAAGAAAAATAAATGTAAGAAGAAATAACAAAGGAACAA
AAAATTTTAGATAAGGAAGAAAATGGAGATTAAAATAATCTAAATGATGAAGGCAGTCGT
AACTAGGAAGAGGCTGAGGAAATCACAAAGATATTGAAAGAAAGTTCAAGCAAAGTAAGT
GAAAAGTATTTAGAGAGCAGGCTTACAGAGGCTGTTGAATGTTACAAGAATAAAAACTTT
GATTAGGCTGAAAATATTTTCTCTGATCTGATGATTTATGCAGTTAAATTTTATAAATCT
GAAACCCATGTGAAGATGTCTAAATACTTCTTTTTTTACGGAGATATGCTTCTTTCTAAA
CTTGAAAATAATCCAGATGTCTTTGGAGATAAAGCTTAAAAAAAATTAGACAATTAAACT
ACTGAAGAAGTTGAAAAAAATCCTAATTAAATGGCATCTGAAGAAGCTAGTGAATAGAAA
ATGGTTGCTTAAAAAGAATAAAAAGAGGAGGATGAAGAAGAAAACGAAGAATCTTAGTCC
TAAGGTATTTGAAACAAATATAAACTTTAAAATAATTTATTTTTGATCATAAAAATATAT
TTAAAGCACTTAAAAGAGTGAGGAATTTCACATAAACAAAAATTTTTATAATAAATAAGG
AGAAGAAGAAATTGTTTAGCTAGACACAGTTATTTTTAAAGATGAAAATGTAGAAATTAG
AGATGAAACTAATGCACCATAAAATAATGAAGAAAATTAAACTGAAGAAAACAATCTACC
AATTGGTAAAGTGACTATGGAAAAGTCAGATCCTATTGATGATTTATAGTTAGCTTGGGA
AAATTTGGAATTAAGTCGTAAGATTTATAATTAAGAGTTGTTATAATTATAAGATAGCTA
AGATGAGGATAGAAAAGAAAAATAAATTTAAGTCAAAAAATAAATAGTCGAAGTAACTTT
AAGAATTGCTGATTTAGAATAATGGAGGGATAATTTCTCAGATGCTTTAAAGGAATACAC
TATGTAAATAATTATCTATATTAGGAGAAAAAACTTATCTTTTAATTTTAAATAGGGCTC
TTTAGTTGTCAAAAGAAATAGAAGATAGGGAGTATAGCAGAACTTTGAGCAGTATTTTCT
TTTAATTAGGAAACGCTGTACTTTATGAAAATAAAGAATATTGTGAAGAAGAGGGTCTTA
AAAATTTTATTGACAGTGCATAAATATTAGAAAATTGTCTTTCAAAAAAAATAGCAATTC
CTCCTTAAGAACTTCCTAGCTTCAAAATATTAAAAAAAGACGATATTAAAGTCGACCATT
TAAAACACAGCTTTTTGGATGATGATGAATCAAAGGAAATTAAAGATACTCTAAAAGTTT
TATATGAAAAAATTGAAGACACCTTGATACAAAGGGATGAAAGAGATAAGTACAAAGCTT
ACTAAGAACTTATGAAAAAATAATCTCAAAATTAAAATCAATTTGCCTAACCTTCATAAA
ATAGTGTTCCTATCAAAAATTTAGGTACATTTGGATCCTTAAAAAGAAAAGAACCTTCTT
CTGAAAACAGCAATTCTTAAAATGGTTCTTCAACTACTATGAATATCCCACCTTAAGAAT
CAGGTAATAGTCAACAATCATCTAATGGTTCTCATATTAGTCCTGATGGAAACCCAGATA
AAATGCTCAAAAAGGATTGA