Identifiers and Description

Gene Model Identifier

TTHERM_01014770

Standard Name

NRP1 (N1/N2-related protein)

Aliases

PreTt04607 | 197.m00081 | 3748.m00317

Description

N1/N2,NASP-related protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_01014770

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20230.19.997093137033517e-262hypothetical protein (518 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88
  2. Ref:24120531: Garg J, Lambert JP, Karsou A, Marquez S, Nabeel-Shah S, Bertucci V, Retnasothie DV, Radovani E, Pawson T, Gingras AC, Pearlman RE, Fillingham JS (2013) Conserved Asf1-importin ? physical interaction in growth and sexual development in the ciliate Tetrahymena thermophila. Journal of proteomics 94( ):311-26

Sequences

>TTHERM_01014770(coding)
ATGAGTTCTGACAATAGTGAATAAGAAAAATAAATGTAAGAAGAAATAACAAAGGAACAA
AAAATTTTAGATAAGGAAGAAAATGGAGATTAAAATAATCTAAATGATGAAGGCAGTCGT
AACTAGGAAGAGGCTGAGGAAATCACAAAGATATTGAAAGAAAGTTCAAGCAAAGTAAGT
GAAAAGTATTTAGAGAGCAGGCTTACAGAGGCTGTTGAATGTTACAAGAATAAAAACTTT
GATTAGGCTGAAAATATTTTCTCTGATCTGATGATTTATGCAGTTAAATTTTATAAATCT
GAAACCCATGTGAAGATGTCTAAATACTTCTTTTTTTACGGAGATATGCTTCTTTCTAAA
CTTGAAAATAATCCAGATGTCTTTGGAGATAAAGCTTAAAAAAAATTAGACAATTAAACT
ACTGAAGAAGTTGAAAAAAATCCTAATTAAATGGCATCTGAAGAAGCTAGTGAATAGAAA
ATGGTTGCTTAAAAAGAATAAAAAGAGGAGGATGAAGAAGAAAACGAAGAATCTTAGTCC
TAAGGAGAAGAAGAAATTGTTTAGCTAGACACAGTTATTTTTAAAGATGAAAATGTAGAA
ATTAGAGATGAAACTAATGCACCATAAAATAATGAAGAAAATTAAACTGAAGAAAACAAT
CTACCAATTGGTAAAGTGACTATGGAAAAGTCAGATCCTATTGATGATTTATAGTTAGCT
TGGGAAAATTTGGAATTAAGTCGTAAGATTTATAATTAAGAGTTGTTATAATTATAAGAT
AGCTAAGATGAGGATAGAAAAGAAAAATAAATTTAAGTCAAAAAATAAATAGTCGAAGTA
ACTTTAAGAATTGCTGATTTAGAATAATGGAGGGATAATTTCTCAGATGCTTTAAAGGAA
TACACTATGGCTCTTTAGTTGTCAAAAGAAATAGAAGATAGGGAGTATAGCAGAACTTTG
AGCAGTATTTTCTTTTAATTAGGAAACGCTGTACTTTATGAAAATAAAGAATATTGTGAA
GAAGAGGGTCTTAAAAATTTTATTGACAGTGCATAAATATTAGAAAATTGTCTTTCAAAA
AAAATAGCAATTCCTCCTTAAGAACTTCCTAGCTTCAAAATATTAAAAAAAGACGATATT
AAAGTCGACCATTTAAAACACAGCTTTTTGGATGATGATGAATCAAAGGAAATTAAAGAT
ACTCTAAAAGTTTTATATGAAAAAATTGAAGACACCTTGATACAAAGGGATGAAAGAGAT
AAGTACAAAGCTTACTAAGAACTTATGAAAAAATAATCTCAAAATTAAAATCAATTTGCC
TAACCTTCATAAAATAGTGTTCCTATCAAAAATTTAGGTACATTTGGATCCTTAAAAAGA
AAAGAACCTTCTTCTGAAAACAGCAATTCTTAAAATGGTTCTTCAACTACTATGAATATC
CCACCTTAAGAATCAGGTAATAGTCAACAATCATCTAATGGTTCTCATATTAGTCCTGAT
GGAAACCCAGATAAAATGCTCAAAAAGGATTGA


>TTHERM_01014770(protein)
MSSDNSEQEKQMQEEITKEQKILDKEENGDQNNLNDEGSRNQEEAEEITKILKESSSKVS
EKYLESRLTEAVECYKNKNFDQAENIFSDLMIYAVKFYKSETHVKMSKYFFFYGDMLLSK
LENNPDVFGDKAQKKLDNQTTEEVEKNPNQMASEEASEQKMVAQKEQKEEDEEENEESQS
QGEEEIVQLDTVIFKDENVEIRDETNAPQNNEENQTEENNLPIGKVTMEKSDPIDDLQLA
WENLELSRKIYNQELLQLQDSQDEDRKEKQIQVKKQIVEVTLRIADLEQWRDNFSDALKE
YTMALQLSKEIEDREYSRTLSSIFFQLGNAVLYENKEYCEEEGLKNFIDSAQILENCLSK
KIAIPPQELPSFKILKKDDIKVDHLKHSFLDDDESKEIKDTLKVLYEKIEDTLIQRDERD
KYKAYQELMKKQSQNQNQFAQPSQNSVPIKNLGTFGSLKRKEPSSENSNSQNGSSTTMNI
PPQESGNSQQSSNGSHISPDGNPDKMLKKD


>TTHERM_01014770(gene)
ATGAGTTCTGACAATAGTGAATAAGAAAAATAAATGTAAGAAGAAATAACAAAGGAACAA
AAAATTTTAGATAAGGAAGAAAATGGAGATTAAAATAATCTAAATGATGAAGGCAGTCGT
AACTAGGAAGAGGCTGAGGAAATCACAAAGATATTGAAAGAAAGTTCAAGCAAAGTAAGT
GAAAAGTATTTAGAGAGCAGGCTTACAGAGGCTGTTGAATGTTACAAGAATAAAAACTTT
GATTAGGCTGAAAATATTTTCTCTGATCTGATGATTTATGCAGTTAAATTTTATAAATCT
GAAACCCATGTGAAGATGTCTAAATACTTCTTTTTTTACGGAGATATGCTTCTTTCTAAA
CTTGAAAATAATCCAGATGTCTTTGGAGATAAAGCTTAAAAAAAATTAGACAATTAAACT
ACTGAAGAAGTTGAAAAAAATCCTAATTAAATGGCATCTGAAGAAGCTAGTGAATAGAAA
ATGGTTGCTTAAAAAGAATAAAAAGAGGAGGATGAAGAAGAAAACGAAGAATCTTAGTCC
TAAGGTATTTGAAACAAATATAAACTTTAAAATAATTTATTTTTGATCATAAAAATATAT
TTAAAGCACTTAAAAGAGTGAGGAATTTCACATAAACAAAAATTTTTATAATAAATAAGG
AGAAGAAGAAATTGTTTAGCTAGACACAGTTATTTTTAAAGATGAAAATGTAGAAATTAG
AGATGAAACTAATGCACCATAAAATAATGAAGAAAATTAAACTGAAGAAAACAATCTACC
AATTGGTAAAGTGACTATGGAAAAGTCAGATCCTATTGATGATTTATAGTTAGCTTGGGA
AAATTTGGAATTAAGTCGTAAGATTTATAATTAAGAGTTGTTATAATTATAAGATAGCTA
AGATGAGGATAGAAAAGAAAAATAAATTTAAGTCAAAAAATAAATAGTCGAAGTAACTTT
AAGAATTGCTGATTTAGAATAATGGAGGGATAATTTCTCAGATGCTTTAAAGGAATACAC
TATGTAAATAATTATCTATATTAGGAGAAAAAACTTATCTTTTAATTTTAAATAGGGCTC
TTTAGTTGTCAAAAGAAATAGAAGATAGGGAGTATAGCAGAACTTTGAGCAGTATTTTCT
TTTAATTAGGAAACGCTGTACTTTATGAAAATAAAGAATATTGTGAAGAAGAGGGTCTTA
AAAATTTTATTGACAGTGCATAAATATTAGAAAATTGTCTTTCAAAAAAAATAGCAATTC
CTCCTTAAGAACTTCCTAGCTTCAAAATATTAAAAAAAGACGATATTAAAGTCGACCATT
TAAAACACAGCTTTTTGGATGATGATGAATCAAAGGAAATTAAAGATACTCTAAAAGTTT
TATATGAAAAAATTGAAGACACCTTGATACAAAGGGATGAAAGAGATAAGTACAAAGCTT
ACTAAGAACTTATGAAAAAATAATCTCAAAATTAAAATCAATTTGCCTAACCTTCATAAA
ATAGTGTTCCTATCAAAAATTTAGGTACATTTGGATCCTTAAAAAGAAAAGAACCTTCTT
CTGAAAACAGCAATTCTTAAAATGGTTCTTCAACTACTATGAATATCCCACCTTAAGAAT
CAGGTAATAGTCAACAATCATCTAATGGTTCTCATATTAGTCCTGATGGAAACCCAGATA
AAATGCTCAAAAAGGATTGA