Identifiers and Description

Gene Model Identifier

TTHERM_01027700

Standard Name

NRK9 (NIMA-Related Kinase)

Aliases

PreTt17999 | 203.m00054 | 3803.m00213

Description

NIMA-Related Kinase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01027700

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20111.19.997093137033517e-262protein kinase domain-containi
ng protein (1875 aa)
OxytrichaContig4942.0.g744.000904604388404e-59Protein kinase domain
WormBaseWBGene000214619.99893167504554e-35locus:nekl-1 status:Partiall
y_confirmed UniProt:Q6AW07
protein_id:CCD69902.1
DictyBaseDDB_G02892779.99893167504554e-35nek4 on chromosome: 5 position
2561379 to 2563106
Stentor CoeruleusSteCoe_118131.0806392777072785e-30
SGDYHR102W6.9997332827772725e-22KIC1 Protein kinase of the PAK
/Ste20 family, required for ce
ll integrity; physically inter
acts with Cdc31p (centrin), wh
ich is a component of the spin
dle pole body; part of the RAM
network that regulates cellul
ar polarity and morphogenesis

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16611747: Wloga D, Camba A, Rogowski K, Manning G, Jerka-Dziadosz M, Gaertig J (2006) Members of the NIMA-related kinase family promote disassembly of cilia by multiple mechanisms. Molecular biology of the cell 17(6):2799-810

Sequences

>TTHERM_01027700(coding)
ATGGACGATACAATTTCTTCTTTTGGAACATTTGCTTCTCCAGTCAAGCCAAATTCTAAA
TTAAATGATTTCAAGATTCTATGTAAATTAGGCGAAGGATCATTTTCAACTGTGTTTAAA
GTACTCCGTTTAGTAGATAACAAGATTTATGCCATGAAGAAGGTTTAAATGAGCAGATTA
AATGAAAAGGAAAAAGGAAATTCTTTAAATGAAATAAGAATTTTAGCTTCAATAAAGTGC
GATCATATTATAGAATACAGAGACAGCTTTTTTGATGATTAATCAGACACACTTTGTATA
GTTATGGAGTATGCAGGTAGTGGTGATTTACTTCAAAAATTAAAAGAGTATAAGCTAATA
AATGAAAAATTACTTGAGGATGGATAAAATGAAACAAGTGAGAGCCAGGTAGAACAAGAT
TCATCTCCAAAAGAAGAAAGTGATAAAAGTTCTCGTTCTTAAGAGAAAAACAAGCGCATA
TACAACAAACTCAATTAATAAAATGAAAGTATTAAATCAAAGAAATCATCAATATAAGAA
AACTCAAGTAAGTCTGTGGTGTAAGATAAGCAATAATAGATGGTTTTTATGGATGAAGAG
TTGATTTGGGATTATTTTATTCAATGTTTGAAAGGTTTAAAGTGCTTGCATGACTTGAAA
ATCGTACATCGTGATTTAAAATGTGCAAATATATTTATAGGTGATAATAATATTATTAAA
ATTGGAGATCTAAATGTATCCAAAGTTACAAGAAGGCCAGAGTAAATGGCTAAAACGCAA
ACAGGTACTCCTTATTATACTGCACCTGAAGTGTGGAAAGGGTTGTCTTATAACTATAAA
AGCGATGTTTGGTCTTTGGGATGTATAATATATGAGCTTTCCGCTTAAAAGCATCCTTTT
AAAGGAAATACAATTGAAGGGCTATTTACTAATATAATGAAAGGATAGTATGAAAGAATA
CCAAGTTTTTATTCTGAAGAATTAGCTTTTGTTATATCTTAATGTTTGCTTTAGAATCCC
AAGCTGAGACCAGGATGCGATCAGCTTTTAAAATTGCCTGCATTTGCTTCAAGACTGTAA
AAATATGAAGAAAAGTATAGGTAGTATTTGCAAAATCATAACAAGTAAAAAATTCATTCT
AACTTCCTTAATGTGACATCGTAAAACCATCTTGAGTTTACCCCCTAAAGAGTATAAAAG
ACCAACACTGAAGGACCCCATCTTATCGATACTATTAATATGCCTTCTAACTTAAAATAG
TTGTCTGCTCTCTTACCTAAATCTAACTATGAAGATACCCCAATTTAACTTCCTTCAATA
AGTGAATTTGATGAAAATATTGTTAATAACAATAATCATTTGCACAATAAAAGCAACTTC
ATGAAATTAAGAGCTTCTGTTCAAAAAGTTTCTGAATTTGATTAGCTTGAGAAGATATCT
TCTGCAGATTCTTCATCATCATCTTCCTCACCATCAGCAGCTACAAACAGAATAACCAAG
AATTTCAAGGATAATAATGAACTGTAAAATGATCAATTAAAGACCTCGTAGATGCACCAA
GATAATATATTTTAAGCTTTATTGGACCTTCAACCAGCTGATATTCTTAATCAAAAATTA
ACTTTAACTTAGTAATAAAAGGAAACTACAAAATTAACAAATAAAAAGATGAGTTAGCTC
TAACCTTATCATGATTTAGTCAATGATTCTCCAATACGTTTTAATCTTCAAAAGGTATAG
ATGGAAAACAAAAATTAAGAGCAGAAAAGTGATGAAAAAAAAGAAAATAGCGAAAGAAAG
AATATAACTCTATAGAAAATAGATTTCATTAATGAGCAAAAGAATCACAGTGGCTTGAGT
TAAAATAATAATACTAAAAATACAATAAGTACAAATGCCCAGACTTTCAAAAATAATGAT
GCAAGCAATAAAAAGTAAAGCTACCAAACATCATCAAATAAAAATGAAGAAGGCATAACC
TCAAGAGGCTCTCCTAATATTTCTTTAGTTGAAAACATTAGCATTTAAGAAAAAAACCCA
ACTTTAAATTCTTAAAATAATAGCTTAGAAGTCATTAGCAACTACATGAAGAAGTTAAAG
ATGCGTCCTCAAAGCTCTGCAATTAGAAATTGTATTACAGTTGAGTGCTAAAACAACTCT
AGCAAATGCAGTAGTATTTTAAATGTAGCTCCTCATCCTTCTCAACAAAATTTAGAAATA
AATTAATAGTAAACTCTAATTACAGAAGAGACATGCCCAAAATTCATTGTTCCTAATGTT
AGATATTCCCAAAATTCTAGTAATATTATCTAAACATAGAGCACTTTTGGGGAAGAGAGT
TTTCTCAATAAAAAGCTAAAAAACGTAAATGGCTATTACAATGATGTGAGAAATTATCGT
ATTCGCTATGCTAGATAAGGATCTAAAGATAATAGGATATAAGCTAGTAATATAAATTCT
AATGTAAATTCCTCTTTCAATAATTATAATAATAATAACAGTTCATTTAACAATAACTAC
AATAGTAATGTAAATAATTCATTTAATAACTATAACTACAATAAAAAAATATTAAAATCT
GAGGAAGACTCTACAAGCTATTCACCATCGGCTTTAGCAAGAGGATTTATTGTTCCTTAT
AGTGCAATTTAGCATGATAAAAATTCTAGAATTAGCACTATTATTTCTTCATCTTCTTAA
TAACCCCGTAGACTTCCTTCTTCTGGTAGAAATAACCAGAAAAAGAGCTATTCACCTATA
AATAAAATAACTTAATTCACTTAATTAATGAAAAGATATTTACCTAAAGGAATGCTCAAA
AACTGTCCAGTTTCAAATCAGGAAAGAAATAATTCTAACAATTCTTCTATCAACTAAAAT
AATCACAGAAGTCCTATAGTATATTAAAAGACCCCTAATTCAGCTAAATATCCTTCTCAT
AAAATAGCAGCTGCAGCAGCTTTTAATACAAGTTTAGTTTCATAGCTAAATAATAGCTCC
ATAAACAGTAACAACTACTCATTTAATAACCAAAATATATCTCCTGTCATCACTTCTAAT
AAAGAAAATGTAAATACAGCAAATATTCTTGACAACAGCTTTGCTTTGATTCGTCATTAA
GCAAGATAAAATATCTATAAAAATAATAATTAGTAAAATGGTGGAGTTAGAGCTGTTTAA
TACGAAAAAAATTTTTTTAATAACAACAACAATAACAATCATTTGAATTGTAACACAAAT
CATATCTAAATAGTTAAAAAACTAGGAAACGTAAATAATGTTTTAAACTCTCATACTTAC
AACATAAATCGCTCATCTCCACCTAAAAAAGCCTAATAAAAAGATTCATAGCATAGAAAA
AATATTTTCTATCACCCAAATTATATAAATTGTTTAAATTAAAATATTAATAGCTCTATT
GTGTAAAAAGTGGCTTATGTGCAAAATCCAAAAAGTTTAAACTCTAAAATTAGCACTTCC
AACAACCAAAGCAGCTCTCAAGAAAGAAAATAAATTAAATAAATCTTGAGGTGA


>TTHERM_01027700(protein)
MDDTISSFGTFASPVKPNSKLNDFKILCKLGEGSFSTVFKVLRLVDNKIYAMKKVQMSRL
NEKEKGNSLNEIRILASIKCDHIIEYRDSFFDDQSDTLCIVMEYAGSGDLLQKLKEYKLI
NEKLLEDGQNETSESQVEQDSSPKEESDKSSRSQEKNKRIYNKLNQQNESIKSKKSSIQE
NSSKSVVQDKQQQMVFMDEELIWDYFIQCLKGLKCLHDLKIVHRDLKCANIFIGDNNIIK
IGDLNVSKVTRRPEQMAKTQTGTPYYTAPEVWKGLSYNYKSDVWSLGCIIYELSAQKHPF
KGNTIEGLFTNIMKGQYERIPSFYSEELAFVISQCLLQNPKLRPGCDQLLKLPAFASRLQ
KYEEKYRQYLQNHNKQKIHSNFLNVTSQNHLEFTPQRVQKTNTEGPHLIDTINMPSNLKQ
LSALLPKSNYEDTPIQLPSISEFDENIVNNNNHLHNKSNFMKLRASVQKVSEFDQLEKIS
SADSSSSSSSPSAATNRITKNFKDNNELQNDQLKTSQMHQDNIFQALLDLQPADILNQKL
TLTQQQKETTKLTNKKMSQLQPYHDLVNDSPIRFNLQKVQMENKNQEQKSDEKKENSERK
NITLQKIDFINEQKNHSGLSQNNNTKNTISTNAQTFKNNDASNKKQSYQTSSNKNEEGIT
SRGSPNISLVENISIQEKNPTLNSQNNSLEVISNYMKKLKMRPQSSAIRNCITVECQNNS
SKCSSILNVAPHPSQQNLEINQQQTLITEETCPKFIVPNVRYSQNSSNIIQTQSTFGEES
FLNKKLKNVNGYYNDVRNYRIRYARQGSKDNRIQASNINSNVNSSFNNYNNNNSSFNNNY
NSNVNNSFNNYNYNKKILKSEEDSTSYSPSALARGFIVPYSAIQHDKNSRISTIISSSSQ
QPRRLPSSGRNNQKKSYSPINKITQFTQLMKRYLPKGMLKNCPVSNQERNNSNNSSINQN
NHRSPIVYQKTPNSAKYPSHKIAAAAAFNTSLVSQLNNSSINSNNYSFNNQNISPVITSN
KENVNTANILDNSFALIRHQARQNIYKNNNQQNGGVRAVQYEKNFFNNNNNNNHLNCNTN
HIQIVKKLGNVNNVLNSHTYNINRSSPPKKAQQKDSQHRKNIFYHPNYINCLNQNINSSI
VQKVAYVQNPKSLNSKISTSNNQSSSQERKQIKQILR


>TTHERM_01027700(gene)
ATGGACGATACAATTTCTTCTTTTGGAACATTTGCTTCTCCAGTCAAGCCAAATTCTAAA
TTAAATGATTTCAAGATTCTATGTAAATTAGGCGAAGGATCATTTTCAACTGTGTTTAAA
GTACTCCGTTTAGTAGATAACAAGATTTATGCCATGAAGAAGGTTTAAATGAGCAGATTA
AATGAAAAGGAAAAAGGAAATTCTTTAAATGAAATAAGAATTTTAGCTTCAATAAAGTGC
GATCATATTATAGAATACAGAGACAGCTTTTTTGATGATTAATCAGACACACTTTGTATA
GTTATGGAGTATGCAGGTAGTGGTGATTTACTTCAAAAATTAAAAGAGTATAAGCTAATA
AATGAAAAATTACTTGAGGATGGATAAAATGAAACAAGTGAGAGCCAGGTAGAACAAGAT
TCATCTCCAAAAGAAGAAAGTGATAAAAGTTCTCGTTCTTAAGAGAAAAACAAGCGCATA
TACAACAAACTCAATTAATAAAATGAAAGTATTAAATCAAAGAAATCATCAATATAAGAA
AACTCAAGTAAGTCTGTGGTGTAAGATAAGCAATAATAGATGGTTTTTATGGATGAAGAG
TTGATTTGGGATTATTTTATTCAATGTTTGAAAGGTTTAAAGTGCTTGCATGACTTGAAA
ATCGTACATCGTGATTTAAAATGTGCAAATATATTTATAGGTGATAATAATATTATTAAA
ATTGGAGATCTAAATGTATCCAAAGTTACAAGAAGGCCAGAGTAAATGGCTAAAACGCAA
ACAGGTACTCCTTATTATACTGCACCTGAAGTGTGGAAAGGGTTGTCTTATAACTATAAA
AGCGATGTTTGGTCTTTGGGATGTATAATATATGAGCTTTCCGCTTAAAAGCATCCTTTT
AAAGGAAATACAATTGAAGGGCTATTTACTAATATAATGAAAGGATAGTATGAAAGAATA
CCAAGTTTTTATTCTGAAGAATTAGCTTTTGTTATATCTTAATGTTTGCTTTAGAATCCC
AAGCTGAGACCAGGATGCGATCAGCTTTTAAAATTGCCTGCATTTGCTTCAAGACTGTAA
AAATATGAAGAAAAGTATAGGTAGTATTTGCAAAATCATAACAAGTAAAAAATTCATTCT
AACTTCCTTAATGTGACATCGTAAAACCATCTTGAGTTTACCCCCTAAAGAGTATAAAAG
ACCAACACTGAAGGACCCCATCTTATCGATACTATTAATATGCCTTCTAACTTAAAATAG
TTGTCTGCTCTCTTACCTAAATCTAACTATGAAGATACCCCAATTTAACTTCCTTCAATA
AGTGAATTTGATGAAAATATTGTTAATAACAATAATCATTTGCACAATAAAAGCAACTTC
ATGAAATTAAGAGCTTCTGTTCAAAAAGTTTCTGAATTTGATTAGCTTGAGAAGATATCT
TCTGCAGATTCTTCATCATCATCTTCCTCACCATCAGCAGCTACAAACAGAATAACCAAG
AATTTCAAGGATAATAATGAACTGTAAAATGATCAATTAAAGACCTCGTAGATGCACCAA
GATAATATATTTTAAGCTTTATTGGACCTTCAACCAGCTGATATTCTTAATCAAAAATTA
ACTTTAACTTAGTAATAAAAGGAAACTACAAAATTAACAAATAAAAAGATGAGTTAGCTC
TAACCTTATCATGATTTAGTCAATGATTCTCCAATACGTTTTAATCTTCAAAAGGTATAG
ATGGAAAACAAAAATTAAGAGCAGAAAAGTGATGAAAAAAAAGAAAATAGCGAAAGAAAG
AATATAACTCTATAGAAAATAGATTTCATTAATGAGCAAAAGAATCACAGTGGCTTGAGT
TAAAATAATAATACTAAAAATACAATAAGTACAAATGCCCAGACTTTCAAAAATAATGAT
GCAAGCAATAAAAAGTAAAGCTACCAAACATCATCAAATAAAAATGAAGAAGGCATAACC
TCAAGAGGCTCTCCTAATATTTCTTTAGTTGAAAACATTAGCATTTAAGAAAAAAACCCA
ACTTTAAATTCTTAAAATAATAGCTTAGAAGTCATTAGCAACTACATGAAGAAGTTAAAG
ATGCGTCCTCAAAGCTCTGCAATTAGAAATTGTATTACAGTTGAGTGCTAAAACAACTCT
AGCAAATGCAGTAGTATTTTAAATGTAGCTCCTCATCCTTCTCAACAAAATTTAGAAATA
AATTAATAGTAAACTCTAATTACAGAAGAGACATGCCCAAAATTCATTGTTCCTAATGTT
AGATATTCCCAAAATTCTAGTAATATTATCTAAACATAGAGCACTTTTGGGGAAGAGAGT
TTTCTCAATAAAAAGCTAAAAAACGTAAATGGCTATTACAATGATGTGAGAAATTATCGT
ATTCGCTATGCTAGATAAGGATCTAAAGATAATAGGATATAAGCTAGTAATATAAATTCT
AATGTAAATTCCTCTTTCAATAATTATAATAATAATAACAGTTCATTTAACAATAACTAC
AATAGTAATGTAAATAATTCATTTAATAACTATAACTACAATAAAAAAATATTAAAATCT
GAGGAAGACTCTACAAGCTATTCACCATCGGCTTTAGCAAGAGGATTTATTGTTCCTTAT
AGTGCAATTTAGCATGATAAAAATTCTAGAATTAGCACTATTATTTCTTCATCTTCTTAA
TAACCCCGTAGACTTCCTTCTTCTGGTAGAAATAACCAGAAAAAGAGCTATTCACCTATA
AATAAAATAACTTAATTCACTTAATTAATGAAAAGATATTTACCTAAAGGAATGCTCAAA
AACTGTCCAGTTTCAAATCAGGAAAGAAATAATTCTAACAATTCTTCTATCAACTAAAAT
AATCACAGAAGTCCTATAGTATATTAAAAGACCCCTAATTCAGCTAAATATCCTTCTCAT
AAAATAGCAGCTGCAGCAGCTTTTAATACAAGTTTAGTTTCATAGCTAAATAATAGCTCC
ATAAACAGTAACAACTACTCATTTAATAACCAAAATATATCTCCTGTCATCACTTCTAAT
AAAGAAAATGTAAATACAGCAAATATTCTTGACAACAGCTTTGCTTTGATTCGTCATTAA
GCAAGATAAAATATCTATAAAAATAATAATTAGTAAAATGGTGGAGTTAGAGCTGTTTAA
TACGAAAAAAATTTTTTTAATAACAACAACAATAACAATCATTTGAATTGTAACACAAAT
CATATCTAAATAGTTAAAAAACTAGGAAACGTAAATAATGTTTTAAACTCTCATACTTAC
AACATAAATCGCTCATCTCCACCTAAAAAAGCCTAATAAAAAGATTCATAGCATAGAAAA
AATATTTTCTATCACCCAAATTATATAAATTGTTTAAATTAAAATATTAATAGCTCTATT
GTGTAAAAAGTGGCTTATGTGCAAAATCCAAAAAGTTTAAACTCTAAAATTAGCACTTCC
AACAACCAAAGCAGCTCTCAAGAAAGAAAATAAATTAAATAAATCTTGAGGTGA