Identifiers and Description

Gene Model Identifier

TTHERM_01144900

Standard Name

NRK8 (NIMA-Related Kinase )

Aliases

PreTt01405 | 253.m00030

Description

NIMA-Related Kinase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.9%

TetraMine Data

TTHERM_01144900

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19315.19.997093137033517e-262protein kinase domain-containi
ng protein (828 aa)
OxytrichaContig18762.0.g761.0003391709219401e-98Protein kinase domain
DictyBaseDDB_G02708143.0012565309061457e-65nek2 on chromosome: 1 position
4847143 to 4848761
WormBaseWBGene000089561.9990871925214856e-61locus:nekl-3 status:Confirme
d UniProt:G5EFM9 protein_i
d:CAA92169.2
Stentor CoeruleusSteCoe_240131.5007857627073948e-41
SGDYAR018C3.0013534825799953e-36KIN3 Nonessential serine/threo
nine protein kinase; possible
role in DNA damage response

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16611747: Wloga D, Camba A, Rogowski K, Manning G, Jerka-Dziadosz M, Gaertig J (2006) Members of the NIMA-related kinase family promote disassembly of cilia by multiple mechanisms. Molecular biology of the cell 17(6):2799-810

Sequences

>TTHERM_01144900(coding)
ATGCCAAAATTTTTGAGGTACTAAATTCGCTCTACCCATTAAAAAAAAATTGCACATACC
AAAAATTCCATTTATTATTTGATTTCCTTAAAAATTGCAGTAACAATTAGAAAACAATAA
ATTAAGCTTATTATTAAGGAGATAGCAATTCTACAAAGTTAACAACTCAATAAATTATTA
GGAAAAAGCAAATTTGTATTAACCTTTTTGAAATCTCTTCATATATTTGTGTAGTAAATT
CAATATATATTAATGATATCATAATAGTTAAAAAATTAATTAATTATTTTTTTAGAGTAA
GCTGAACTTAAGATTAAGATGACAGATATTTTAAAGAACAAAGTGCAAAATGAATCTAGT
AATTCCGATTAAAATGCAAATAGTGTTTCTTGTTTGTCTGATTTTGAAATACTGAAGAAA
TTAGGATAAGGAGCGCATGGAGTTGTTTATAAAGTTAGGAGAAAAAAAGATCAAAATACC
TATGTGTTAAAATAAATATTAGCAGGCGGAATGTAGCAAAAGTAAAGAAAAGAATGCATT
AATGAAGCAATTCTACTCAACAAATTAAACAGCCCTTATATTGTTAGATATTATGATAGC
TTTTTAGAAAACAATTAGCTCTGTATCGTGATGGAATACTGTGAATAAGGTGATCTTGAG
AATTTTATCAAAAACTAAATGGGTAGACCTTTAGTAGAAAAAAAAATTTGGAAATTCTTT
TTCTAAATTGCAGAAGGTCTCCTTGAATTGCACACGAGAAATATATTGCATAGAGATATT
AAGACTATGAATCTATTTTTAACAGGTAACGAATAAATAAGGATCGGAGATTTGGGAGTT
GCTAAATAATTAGAAAATAACAAATCACATGCCCATTCTCAAGTGGGAACACCTTATTAC
ATGTCTCCTGAAATTATTTAAGACATTCCATACAATGAAAAAAGCGATGTATGGTCACTA
GGATGTGTATTATATTAACTAGCTACCTTTAAAAGACCTTTTGAAGCAACAAATTAAGGC
TCTCTAGTGCTAAAAATTTAAAAAGCTTAATATATACCTATTTCATCTAATTACTCTCCA
TAATTACATAGACTTATAGAGCTATGTCTGACAAAAGAACACTAAAAAAGGTATTCAATA
AAATAGCTACTCACAGATCCTGAAATAGAAATGAAAGCGAAGCAAATAGGCCATTCTTTG
AAGGCGGTTTAGCAGCTTATAGCTCAAAATTACTAAGATGAAACTAAAATTGAATAGGAG
TCTCCAGCAAAGATCATTAAAAGCAAGGATTTTATTTTATTTTAAACTAAAAAAAATGAT
AATTCTCTCAGCCAAGACAGTACTCCAAAAAGTTAAATAGCTAAAGATTAATAAAATGGC
TCTCCATTAGAAAGATCTAAATTTAGAAATTTTAAGCTTCAAATTATAGCCAATTAAAGT
AGTGGGAATAATTCTGAAAAAGAAACACCTTTGCAAAGTTAAAGTGATCTACATTTTATT
AATTAAGAAAAAAGCGCATCAAAAGTCGAACTTCAAAAATTAATTAAATCTCCTTAAGTT
GTATCAAGAACTAAAAAATTAATTGAATATGGAATTAATAAATCAATAAACTCAACTCCA
AGTGAAAGATTAATTTAAGAATAAAGGGAAAGTTTAGGTAATAACGTTTTTAAATAAAGT
ATTGAAAACTTTAGATCCTATTCTCCTTAAATAAAATTTGATTAACTTAAATGTGACTCT
CCTATCCCATTTAATTAACCAAACCATATGCGATCAACAAAATCTTAATTAGGATTTTAG
TAGATTGGGGTAGGTAATTCAGCTAATTTAAATTCTATGGCAAAGCAACCAATTAGGATT
CGTAAAGAAACTGACTTAAATTTTTCCAAGGTTGTATAACAATAGTAATTGCTAAATTAG
CAACATTTATAAAAAAGCATATCTTGTTAAAACACCTTTAAGACAGTTGACTATGAGGAT
AGAGCAAGTGAATAAAAAGCCTTTCCTTAAATTAAATAATAGTAAGCTTTAAAGAAAATG
AGTATATAATCAAAATAGGAATAAATGAGAAGATATGACTCTTGTGATAAAAATATAAAT
TAAGATAGATTAGTAAATAAATATAATATCAATGATTAAAATACATTTAGTAGTAATAAT
TTTAATAAAATGTTATCTACACAATTTAATTTAACATAGAATAGCACTAATAATATTACC
AATTAAGTAGTAAGTTAAAAGCTTTCTTCTTTGCAAGTATATCCAAAGTAATCTAAGACA
AATGCGGCATTGACTTCTATGAATAGACTTGTGTCAGATATGAGCTAGCATGCTAAAAGT
TATAACACCAAAAAGAGCATGACTCATCTATCTTAAACAGATTTAGATAAGGCGTTTAAT
TAAATGTAAGATGAGGAAGAGACAGAAATAGAAGTGCCGAAAAATACAGATAATCCTTAA
CTATCTAAGTATTATAAATAAAAATTTGAATTATCTGTGCAAAGTTAATAGTTGCAAAAA
GTATGCACGAATATTCTAGGCTAAGAGCTCTACTAAAAAGTATTAGGAAAATTCAAACAC
CATATTAATAGAGAAGTTGATATTTCTAAGCAAGATCAAGACAAAATTAACCTAATAATT
GATACAGACCTAAAATATAAATAAGAATGTGTTAATAAATTATATTAGATTATTTCAATA
GAAAATTAAATTTAAGATTTGAACCAAAAAATTAATTAGATTGAAATCAATAGTTGA


>TTHERM_01144900(protein)
MPKFLRYQIRSTHQKKIAHTKNSIYYLISLKIAVTIRKQQIKLIIKEIAILQSQQLNKLL
GKSKFVLTFLKSLHIFVQQIQYILMISQQLKNQLIIFLEQAELKIKMTDILKNKVQNESS
NSDQNANSVSCLSDFEILKKLGQGAHGVVYKVRRKKDQNTYVLKQILAGGMQQKQRKECI
NEAILLNKLNSPYIVRYYDSFLENNQLCIVMEYCEQGDLENFIKNQMGRPLVEKKIWKFF
FQIAEGLLELHTRNILHRDIKTMNLFLTGNEQIRIGDLGVAKQLENNKSHAHSQVGTPYY
MSPEIIQDIPYNEKSDVWSLGCVLYQLATFKRPFEATNQGSLVLKIQKAQYIPISSNYSP
QLHRLIELCLTKEHQKRYSIKQLLTDPEIEMKAKQIGHSLKAVQQLIAQNYQDETKIEQE
SPAKIIKSKDFILFQTKKNDNSLSQDSTPKSQIAKDQQNGSPLERSKFRNFKLQIIANQS
SGNNSEKETPLQSQSDLHFINQEKSASKVELQKLIKSPQVVSRTKKLIEYGINKSINSTP
SERLIQEQRESLGNNVFKQSIENFRSYSPQIKFDQLKCDSPIPFNQPNHMRSTKSQLGFQ
QIGVGNSANLNSMAKQPIRIRKETDLNFSKVVQQQQLLNQQHLQKSISCQNTFKTVDYED
RASEQKAFPQIKQQQALKKMSIQSKQEQMRRYDSCDKNINQDRLVNKYNINDQNTFSSNN
FNKMLSTQFNLTQNSTNNITNQVVSQKLSSLQVYPKQSKTNAALTSMNRLVSDMSQHAKS
YNTKKSMTHLSQTDLDKAFNQMQDEEETEIEVPKNTDNPQLSKYYKQKFELSVQSQQLQK
VCTNILGQELYQKVLGKFKHHINREVDISKQDQDKINLIIDTDLKYKQECVNKLYQIISI
ENQIQDLNQKINQIEINS


>TTHERM_01144900(gene)
ATGCCAAAATTTTTGAGGTACTAAATTCGCTCTACCCATTAAAAAAAAATTGCACATACC
AAAAATTCCATTTATTATTTGATTTCCTTAAAAATTGCAGTAACAATTAGAAAACAATAA
ATTAAGCTTATTATTAAGGAGATAGCAATTCTACAAAGTTAACAACTCAATAAATTATTA
GGAAAAAGCAAATTTGTATTAACCTTTTTGAAATCTCTTCATATATTTGTGTAGTAAATT
CAATATATATTAATGATATCATAATAGTTAAAAAATTAATTAATTATTTTTTTAGAGTAA
GCTGAACTTAAGATTAAGATGACAGATATTTTAAAGAACAAAGTGCAAAATGAATCTAGT
AATTCCGATTAAAATGCAAATAGTGTTTCTTGTTTGTCTGATTTTGAAATACTGAAGAAA
TTAGGATAAGGAGCGCATGGAGTTGTTTATAAAGTTAGGAGAAAAAAAGATCAAAATACC
TATGTGTTAAAATAAATATTAGCAGGCGGAATGTAGCAAAAGTAAAGAAAAGAATGCATT
AATGAAGCAATTCTACTCAACAAATTAAACAGCCCTTATATTGTTAGATATTATGATAGC
TTTTTAGAAAACAATTAGCTCTGTATCGTGATGGAATACTGTGAATAAGGTGATCTTGAG
AATTTTATCAAAAACTAAATGGGTAGACCTTTAGTAGAAAAAAAAATTTGGAAATTCTTT
TTCTAAATTGCAGAAGGTCTCCTTGAATTGCACACGAGAAATATATTGCATAGAGATATT
AAGACTATGAATCTATTTTTAACAGGTAACGAATAAATAAGGATCGGAGATTTGGGAGTT
GCTAAATAATTAGAAAATAACAAATCACATGCCCATTCTCAAGTGGGAACACCTTATTAC
ATGTCTCCTGAAATTATTTAAGACATTCCATACAATGAAAAAAGCGATGTATGGTCACTA
GGATGTGTATTATATTAACTAGCTACCTTTAAAAGACCTTTTGAAGCAACAAATTAAGGC
TCTCTAGTGCTAAAAATTTAAAAAGCTTAATATATACCTATTTCATCTAATTACTCTCCA
TAATTACATAGACTTATAGAGCTATGTCTGACAAAAGAACACTAAAAAAGGTATTCAATA
AAATAGCTACTCACAGATCCTGGTAAGATAATTGATTTATTATCTTAGATTATTTGATTC
AAAACATTAAAAAAATTTTTTATTGTTATACCTATTATACTTACTATACACAATGTATCA
GTCCATTAAAATTTTAAAAGGGTGATTATAGTTATTGAAATCTATAAAATGGATTAATTA
ATTATTGGTATTTATTTATTAATCAAATGAATATTTTCCAAGAATAGCTCATTCCAATTT
TACTTCATTTAAATTATAATTTTTAAATCAATCGAATAGAAATAGAAATGAAAGCGAAGC
AAATAGGCCATTCTTTGAAGGCGGTTTAGCAGCTTATAGCTCAAAATTACTAAGATGAAA
CTAAAATTGAATAGGAGTCTCCAGCAAAGATCATTAAAAGCAAGGATTTTATTTTATTTT
AAACTAAAAAAAATGATAATTCTCTCAGCCAAGACAGTACTCCAAAAAGTTAAATAGCTA
AAGATTAATAAAATGGCTCTCCATTAGAAAGATCTAAATTTAGAAATTTTAAGCTTCAAA
TTATAGCCAATTAAAGTAGTGGGAATAATTCTGAAAAAGAAACACCTTTGCAAAGTTAAA
GTGATCTACATTTTATTAATTAAGAAAAAAGCGCATCAAAAGTCGAACTTCAAAAATTAA
TTAAATCTCCTTAAGTTGTATCAAGAAGTAATTAATTGTTACTTAAATAAATTTAATAGT
TTTTATTTTTTAAAGAAGATTATTTATTTTTTATTTGATAAATATAAACTTCAATTTATT
TATTTATTTATTTATTTATTTATTTATTTATTCATTCATTCATTCATTCATAATTTAATA
AAATAAAAGCTAAAAAATTAATTGAATATGGAATTAATAAATCAATAAACTCAACTCCAA
GTGAAAGATTAATTTAAGAATAAAGGGAAAGTTTAGGTAATAACGTTTTTAAATAAAGTA
TTGAAAACTTTAGATCCTATTCTCCTTAAATAAAATTTGATTAACTTAAATGTGACTCTC
CTATCCCATTTAATTAACCAAACCATATGCGATCAACAAAATCTTAATTAGGATTTTAGT
AGATTGGGGTAGGTAATTCAGCTAATTTAAATTCTATGGCAAAGCAACCAATTAGGATTC
GTAAAGAAACTGACTTAAATTTTTCCAAGGTTGTATAACAATAGTAATTGCTAAATTAGC
AACATTTATAAAAAAGCATATCTTGTTAAAACACCTTTAAGACAGTTGACTATGAGGATA
GAGCAAGTGAATAAAAAGCCTTTCCTTAAATTAAATAATAGTAAGCTTTAAAGAAAATGA
GTATATAATCAAAATAGGAATAAATGAGAAGATATGACTCTTGTGATAAAAATATAAATT
AAGATAGATTAGTAAATAAATATAATATCAATGATTAAAATACATTTAGTAGTAATAATT
TTAATAAAATGTTATCTACACAATTTAATTTAACATAGAATAGCACTAATAATATTACCA
ATTAAGTAGTAAGTTAAAAGCTTTCTTCTTTGCAAGTATATCCAAAGTAATCTAAGACAA
ATGCGGCATTGACTTCTATGAATAGACTTGTGTCAGATATGAGCTAGCATGCTAAAAGTT
ATAACACCAAAAAGAGCATGACTCATCTATCTTAAACAGATTTAGATAAGGCGTTTAATT
AAATGTAAGATGAGGAAGAGACAGAAATAGAAGTGCCGAAAAATACAGATAATCCTTAAC
TATCTAAGTATTATAAATAAAAATTTGAATTATCTGTGCAAAGTTAATAGTTGCAAAAAG
TATGCACGAATATTCTAGGCTAAGAGCTCTACTAAAAAGTATTAGGAAAATTCAAACACC
ATATTAATGTAATTAATTTATTAAATTATTTAAAATATTAATTTATTTATAACTGAAGAG
AGAAGTTGATATTTCTAAGCAAGATCAAGACAAAATTAACCTAATAATTGATACAGACCT
AAAATATAAATAAGAATGTGTTAATAAATTATATTAGATTATTTCAATAGAAAATTAAAT
TTAAGATTTGAACCAAAAAATTAATTAGATTGAAATCAATAGTTGA