Identifiers and Description

Gene Model Identifier

TTHERM_00821800

Standard Name

NRK6 (NIMA-Related Kinase )

Aliases

PreTt07740 | 140.m00055 | 3759.m00357

Description

NIMA-Related Kinase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00821800

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17499.19.997093137033517e-262protein kinase domain-containi
ng protein (787 aa)
OxytrichaContig2600.0.g1053.000712232670428e-104Protein kinase domain
DictyBaseDDB_G02752412.0008958828286524e-54nek3 on chromosome: 2 position
4983790 to 4987279
Stentor CoeruleusSteCoe_90253.093350011308561e-50
WormBaseWBGene000214612.000704504372864e-47locus:nekl-1 status:Partiall
y_confirmed UniProt:Q6AW07
protein_id:CCD69902.1
SGDYAR018C1.999002769139511e-37KIN3 Nonessential serine/threo
nine protein kinase; possible
role in DNA damage response

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16611747: Wloga D, Camba A, Rogowski K, Manning G, Jerka-Dziadosz M, Gaertig J (2006) Members of the NIMA-related kinase family promote disassembly of cilia by multiple mechanisms. Molecular biology of the cell 17(6):2799-810

Sequences

>TTHERM_00821800(coding)
ATGAAATTGTAGAATTTTGAAATCATTGAAAAATTAGGCGAAGGAGCCTACAGCTAAGTT
TATAAAGTTAAAAGAACTATTGATTAGCAAATATACGCTTTAAAAAAAGTTAATCTTACC
AACTTGTCTCTTAAAGAGAAAGAGAATGCTCTTAACGAAGTCAGAATTATTGCCTCCATC
AGACATCCAAATGTGGTTTCTTTCAAGGAAAGCTTTTTAAGTGATGACGGAGAGTTTCTT
TATTTAGTTATGGAATATGCAGATGATGGTGATGTCTTAGAAAAAATCAAAAAGCACATT
AGAACAGGGACCAGGTTAAGGGAAGATTACATTTGGAGTGTCTTTATTCAAAGCGTTAAA
GGTCTTTAAGTTCTCCATAGTTTAAACATTTATCACAGAGATATCAAAAACGCAAATTTA
TTTTTATACAAAGATGGAACTACTAAAATTGGTGATTTTAACGTTTCCAAACAAGCTAAG
ATGGGGCTTCTATATACGTAAACAGGTACTCCTTACTATGCCAGTCCGGAGGTTTGGAGC
GATCAACCTTACACTAGTTCTAGCGACATATGGAGTTTAGGATGTGTTTTATATGAATTA
GCTACTCTCTCACCTCCTTTTAATGGTGAGTCAATGAAAGAGCTTTATGGAAAAATAATG
AGTGGAGTCTATAAAAAAATATCTCCAAAATACTCATTAGAATTATCCAATATGGTATCA
AATATGCTTTAGATTGATCCCAAAAAGAGATTTTCTTGCTCTTAAATTCTACAACTTCCC
TACATTTAAAAAAAAATATCAGAAAAGCGCATCCTGTCAAGAGAAGAAGAAGAAAAATCC
ACTCTACTTAAAACAATATAATTTAAACCTGTGACTGCGTCACTTCAAGAGAATTTGCCT
TAACCTAATTATCCAAATTCCTATCATAGTAAGAGTGTGAAGAAAATAGTTAATGAATTT
TTAGAAAACTAAGATGATAACAATAATAATGAAAGTAGTTTTTGTTTACAGCCTTCTCCT
AGCATAAAATTAGCAAAAGAAGCAGATTCTTCTGCTAGCCCTCTTGCCAAAAAGCAATAA
AAGATAAATTATTCTAAAAAGGGATCTCTTATCCCTTCATTGAGAGAAATCAAAGCTAAA
AAAAGTATTCCTAAGAATGAAAGAAGTTTGGATAGGTCTAGTAGAAGCAAGATTTCTATA
TAAATAGATAATTAGATTGATACTGACTCAAAAAAGAACGATAATAGCTTCATCTAAAAT
GAAGAAGCAAATTTAAGCATCCAGATAAAAAAGAAGAAGAATAATCCAAGTGAAAATAGC
CTATAAAAGAAAGAATATATTCCAAAAGATCAACAATTCATAAAAGAAAATTACAAAAGA
GGAAGATCTCCTAATTTGAATAGAAATGTTAAAATTTAAGAAGAATATCATATACAAGAG
AAATAGAAAGATAATGAAGGTAGTCTAAATGAAAAAAGGAAGCGCCTTTTAAAAGAAAAT
TCATTTAACCACTAGCTCAGTAATATTTCTTCTCCAAGAGATAATCATACAAGAGGGAGC
AATCATTCTTAGGACTAAAGCAGCATAAGCCAAGGAAAGAATATTTTTCTTCCAATTTTA
TATTAAAATAAATAGTTTCTAAGCTCCTCTAATAGCCCACCTGCTTCTCGGTTGAGATAA
GAGGCTATTACTCGTAAATTGATGAAAGATATGTATGCAGCAAAAGTATAAGAATAAAAT
AAAATTAGAAGTTTAGATAAAAAAAAACAGTTCATTTAGATAGAAATAGAAAAAAACATA
AGATTAATGCCATAAATATAAGGCAGGAATATGAATTAATCAACTGATTCCTCGAGTGAA
AGACAAAAAACAAAAAATAGCAGCAAATTAGAAAGACTAAATGGTTAATTTTAAATTTAA
AAATATACAGGATTATCAAGCATAGAAGAAAAAAAAGAAGATAATTAAATTTAAGATAGT
TAGTTTTACAATTCAGGCTTAGATTCTCATAAAAAATCTTTATAAAAATAGAAATCCATT
GAAAATGAAAAAACAAGCCCATAAAGTTAGATAAAATCATATAAAAGATACAATAATATA
AGAGATTCCCAAGAATAATAGCTAAAACTCTAGCAAAACTCTTTTTCTCCTAATAAACAA
AAAGATGATTTTCATCTACCTTTAATTAGCAAGTCTTCTGTCTTATAAAATTACGATACA
AACGATCTATTACAACCACATAAAAGTATTAACAGAATTAGAATTCCAACTAATCTCCTC
AAAAAAATTGATTTAGAAGAATAGCAATCTTAGTAAACACAATAAACAAAAAAAACCAAT
TAAGTTCTTTCTCTTTAAGATTCTCACAACTCAATGGAAGTAAGAAATAACATTAATGCA
TTATGA


>TTHERM_00821800(protein)
MKLQNFEIIEKLGEGAYSQVYKVKRTIDQQIYALKKVNLTNLSLKEKENALNEVRIIASI
RHPNVVSFKESFLSDDGEFLYLVMEYADDGDVLEKIKKHIRTGTRLREDYIWSVFIQSVK
GLQVLHSLNIYHRDIKNANLFLYKDGTTKIGDFNVSKQAKMGLLYTQTGTPYYASPEVWS
DQPYTSSSDIWSLGCVLYELATLSPPFNGESMKELYGKIMSGVYKKISPKYSLELSNMVS
NMLQIDPKKRFSCSQILQLPYIQKKISEKRILSREEEEKSTLLKTIQFKPVTASLQENLP
QPNYPNSYHSKSVKKIVNEFLENQDDNNNNESSFCLQPSPSIKLAKEADSSASPLAKKQQ
KINYSKKGSLIPSLREIKAKKSIPKNERSLDRSSRSKISIQIDNQIDTDSKKNDNSFIQN
EEANLSIQIKKKKNNPSENSLQKKEYIPKDQQFIKENYKRGRSPNLNRNVKIQEEYHIQE
KQKDNEGSLNEKRKRLLKENSFNHQLSNISSPRDNHTRGSNHSQDQSSISQGKNIFLPIL
YQNKQFLSSSNSPPASRLRQEAITRKLMKDMYAAKVQEQNKIRSLDKKKQFIQIEIEKNI
RLMPQIQGRNMNQSTDSSSERQKTKNSSKLERLNGQFQIQKYTGLSSIEEKKEDNQIQDS
QFYNSGLDSHKKSLQKQKSIENEKTSPQSQIKSYKRYNNIRDSQEQQLKLQQNSFSPNKQ
KDDFHLPLISKSSVLQNYDTNDLLQPHKSINRIRIPTNLLKKIDLEEQQSQQTQQTKKTN
QVLSLQDSHNSMEVRNNINAL


>TTHERM_00821800(gene)
ATGAAATTGTAGAATTTTGAAATCATTGAAAAATTAGGCGAAGGAGCCTACAGCTAAGTT
TATAAAGTTAAAAGAACTATTGATTAGCAAATATACGCTTTAAAAAAAGTTAATCTTACC
AACTTGTCTCTTAAAGAGAAAGAGAATGCTCTTAACGAAGTCAGAATTATTGCCTCCATC
AGACATCCAAATGTGGTTTCTTTCAAGGAAAGCTTTTTAAGTGATGACGGAGAGTTTCTT
TATTTAGTTATGGAATATGCAGATGATGGTGATGTCTTAGAAAAAATCAAAAAGCACATT
AGAACAGGGACCAGGTTAAGGGAAGATTACATTTGGAGTGTCTTTATTCAAAGCGTTAAA
GGTCTTTAAGTTCTCCATAGTTTAAACATTTATCACAGAGATATCAAAAACGCAAATTTA
TTTTTATACAAAGATGGAACTACTAAAATTGGTGATTTTAACGTTTCCAAACAAGCTAAG
ATGGGGCTTCTATATACGTAAACAGGTACTCCTTACTATGCCAGTCCGGAGGTTTGGAGC
GATCAACCTTACACTAGTTCTAGCGACATATGGAGTTTAGGATGTGTTTTATATGAATTA
GCTACTCTCTCACCTCCTTTTAATGGTGAGTCAATGAAAGAGCTTTATGGAAAAATAATG
AGTGGAGTCTATAAAAAAATATCTCCAAAATACTCATTAGAATTATCCAATATGGTATCA
AATATGCTTTAGATTGATCCCAAAAAGAGATTTTCTTGCTCTTAAATTCTACAACTTCCC
TACATTTAAAAAAAAATATCAGAAAAGCGCATCCTGTCAAGAGAAGAAGAAGAAAAATCC
ACTCTACTTAAAACAATATAATTTAAACCTGTGACTGCGTCACTTCAAGAGAATTTGCCT
TAACCTAATTATCCAAATTCCTATCATAGTAAGAGTGTGAAGAAAATAGTTAATGAATTT
TTAGAAAACTAAGATGATAACAATAATAATGAAAGTAGTTTTTGTTTACAGCCTTCTCCT
AGCATAAAATTAGCAAAAGAAGCAGATTCTTCTGCTAGCCCTCTTGCCAAAAAGCAATAA
AAGATAAATTATTCTAAAAAGGGATCTCTTATCCCTTCATTGAGAGAAATCAAAGCTAAA
AAAAGTATTCCTAAGAATGAAAGAAGTTTGGATAGGTCTAGTAGAAGCAAGATTTCTATA
TAAATAGATAATTAGATTGATACTGACTCAAAAAAGAACGATAATAGCTTCATCTAAAAT
GAAGAAGCAAATTTAAGCATCCAGATAAAAAAGAAGAAGAATAATCCAAGTGAAAATAGC
CTATAAAAGAAAGAATATATTCCAAAAGATCAACAATTCATAAAAGAAAATTACAAAAGA
GGAAGATCTCCTAATTTGAATAGAAATGTTAAAATTTAAGAAGAATATCATATACAAGAG
AAATAGAAAGATAATGAAGGTAGTCTAAATGAAAAAAGGAAGCGCCTTTTAAAAGAAAAT
TCATTTAACCACTAGCTCAGTAATATTTCTTCTCCAAGAGATAATCATACAAGAGGGAGC
AATCATTCTTAGGACTAAAGCAGCATAAGCCAAGGAAAGAATATTTTTCTTCCAATTTTA
TATTAAAATAAATAGTTTCTAAGCTCCTCTAATAGCCCACCTGCTTCTCGGTTGAGATAA
GAGGCTATTACTCGTAAATTGATGAAAGATATGTATGCAGCAAAAGTATAAGAATAAAAT
AAAATTAGAAGTTTAGATAAAAAAAAACAGTTCATTTAGATAGAAATAGAAAAAAACATA
AGATTAATGCCATAAATATAAGGCAGGAATATGAATTAATCAACTGATTCCTCGAGTGAA
AGACAAAAAACAAAAAATAGCAGCAAATTAGAAAGACTAAATGGTTAATTTTAAATTTAA
AAATATACAGGATTATCAAGCATAGAAGAAAAAAAAGAAGATAATTAAATTTAAGATAGT
TAGTTTTACAATTCAGGCTTAGATTCTCATAAAAAATCTTTATAAAAATAGAAATCCATT
GAAAATGAAAAAACAAGCCCATAAAGTTAGATAAAATCATATAAAAGATACAATAATATA
AGAGATTCCCAAGAATAATAGCTAAAACTCTAGCAAAACTCTTTTTCTCCTAATAAACAA
AAAGATGATTTTCATCTACCTTTAATTAGCAAGTCTTCTGTCTTATAAAATTACGATACA
AACGATCTATTACAACCACATAAAAGTATTAACAGAATTAGAATTCCAACTAATCTCCTC
AAAAAAATTGATTTAGAAGAATAGCAATCTTAGTAAACACAATAAACAAAAAAAACCAAT
TAAGTTCTTTCTCTTTAAGATTCTCACAACTCAATGGAAGTAAGAAATAACATTAATGCA
TTATGA