Identifiers and Description

Gene Model Identifier

TTHERM_00825150

Standard Name

NRK39 (NIMA-Related Kinase)

Aliases

PreTt03979 | 142.m00076 | 3683.m00009

Description

NIMA-related kinase; Protein kinase domain containing protein. Sequence similarity to the NEK protein kinase family (Eisen et al., 2006).

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00825150

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18311.19.997093137033517e-262protein kinase domain-containi
ng protein (649 aa)
OxytrichaContig1689.0.g144.0008150871967356e-141Protein kinase domain
DictyBaseDDB_G02892774.99918933170902e-62nek4 on chromosome: 5 position
2561379 to 2563106
Stentor CoeruleusSteCoe_13442.3455513385429143e-59
WormBaseWBGene000089564.998711177326993e-55locus:nekl-3 status:Confirme
d UniProt:G5EFM9 protein_i
d:CAA92169.2
SGDYAR018C5.000680012816624e-42KIN3 Nonessential serine/threo
nine protein kinase; possible
role in DNA damage response

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00825150(coding)
ATGTCTCTAAAGGAATTTCCTATCATTCAAAAACTAGGTGAAGGAGCATATAGTAGTGTA
TATAAAGTAAAGAGGATTAGCGATGATAATGAGTATGCGCTTAAAAAAGTTAAGCTCATG
AACCTTTCTGACAAAGAAAAATAAAATGCTTTGAACGAAGTAAGAATTTTAGCTTCTATT
AGATAGCCAAACATAATTGGATATAAGGAAGCTTTTGTCGATGAAATGTCAAACTCATTA
TGTATTGTAATGGAGTATGCAGATAATGGAGATCTCTATTAAAAAATAGTAGAATTTCAA
AAAAAAGGATAACTTTTTCCAGAACAAGAGATATGGCATATTTTTATTTAAATTGTCAAA
GGCCTGAAAGCACTTCATAGCTTATAAATATTTCACAGAGATCTCAAGAGCGCAAATGTG
TTTCTAACTAAAGAAGGTATTGTTAAGTTAGGAGATATGAACGTTTCAAAAGTTGCTAAA
TAAGGATTATTATATACTTAAACGGGTACCCCTTACTACGCCAGTCCAGAAGTGTGGAAA
GATTAAGCATACGACAGTAAATCTGACATTTGGTCATTAGGATGTGTTTTATATGAAATG
ACTACTCTTAAACCACCTTTTAGGGCTGAAGATATGGAAGGTCTTTATAAAAAAGTTATT
AGAGGATACTATCCTAGAATCCCGCCTCATTTCTCTTAAGATCTAGCTAATATTATTAGA
TCCCTTTTATAAGTATCCCCTCAATTAAGACCCTCATGTGATAAAATTCTTTAAATGCCA
GCTGTAATTAAAAGAATGAATGATTCTTTATTAACTGAAGTTGACGAAGCAATTTAAAAT
AACTTGTTGAATACCATAAAAATTCCTAAAAATTTGCATTATCTTACTGATAGATTACCT
AAACCAAATTATGAACCTTTAAAAACTAAGAGAATAGATAAAAGAAGATTTTTGCAAACT
TTAGCAGGGTATACCGATATACCTGATCGTGAATCTCCTTCTCCGTCTCCAGAATAAATG
AAGTAATTGGTACTTCCTAAGATTCCTTAGCAAAGAAAGAATCATCATTCTAACAAAAGT
AATGAGAACGTGCCACCTAATAATAATCCAAGTTCTATTATTAATAATGTGCCAAGCACA
ACTAGCAACAGAGAAGAAATCGATGAAAGAGGAAGTGAAATAAATTAAAATGCATATGAT
GATTAGTCCTCATAAGTTTCTTTAGCTCATAAGGTTCATCCCAGAAGCTTATCTAAAAAG
CATATTAACAAGTATGAAATCCAATCAAAGTATGATAAATATGGTCTGGCTTCTCCAAAT
TACTATCCTGAATCTGTTAAGAGTGATATACATTCAACAAAGCACTCAAAACCAATAGAC
ATACTATAGCTTAAATAACAATATGAATTAAATAACGACAAATCTCTTCAACCAACTTAC
ATTCCAATCAAAAAGAAAAAAGAGCTTTCTCCATTGAAAAAGAAAAAGAATTAAGGAATA
AATCTATTAGATATTGAAGGAGAGTCCAAGCCACTGCTTTCCAAACAGAGAAAAAATAAT
TCTATTGACTAATCTATCATTTATGAAGACCAAAATAATAATGGTAACAGACTTCCAAAC
ATAAATGGCTCAAAACTACCTAGAATAGGAAATTCGAATAGCGGAAGCACTAATAATATG
ATAGGTGGCGGTGTACTAGGCCTGGGCATAGTAGGAAATGCTGCAAGAAGCCTAGACAAA
GAAAATGCAAAAATTAAAGAAATTACTAAAGCCTACAAAGTAAATTTAGATCCTATTAAT
GACTTAAAAGATAGGTACAGATAATTAAAAAAGAATGATAGAACCAAAATTCTTTCTATC
AAGAATGCTAGCATGCCTTAAAGCAATAGTATGGCTTCTTAAGATAAATATTAGTATATT
TATGCTCAGGAAGATGTCTTAAATTCTTGA


>TTHERM_00825150(protein)
MSLKEFPIIQKLGEGAYSSVYKVKRISDDNEYALKKVKLMNLSDKEKQNALNEVRILASI
RQPNIIGYKEAFVDEMSNSLCIVMEYADNGDLYQKIVEFQKKGQLFPEQEIWHIFIQIVK
GLKALHSLQIFHRDLKSANVFLTKEGIVKLGDMNVSKVAKQGLLYTQTGTPYYASPEVWK
DQAYDSKSDIWSLGCVLYEMTTLKPPFRAEDMEGLYKKVIRGYYPRIPPHFSQDLANIIR
SLLQVSPQLRPSCDKILQMPAVIKRMNDSLLTEVDEAIQNNLLNTIKIPKNLHYLTDRLP
KPNYEPLKTKRIDKRRFLQTLAGYTDIPDRESPSPSPEQMKQLVLPKIPQQRKNHHSNKS
NENVPPNNNPSSIINNVPSTTSNREEIDERGSEINQNAYDDQSSQVSLAHKVHPRSLSKK
HINKYEIQSKYDKYGLASPNYYPESVKSDIHSTKHSKPIDILQLKQQYELNNDKSLQPTY
IPIKKKKELSPLKKKKNQGINLLDIEGESKPLLSKQRKNNSIDQSIIYEDQNNNGNRLPN
INGSKLPRIGNSNSGSTNNMIGGGVLGLGIVGNAARSLDKENAKIKEITKAYKVNLDPIN
DLKDRYRQLKKNDRTKILSIKNASMPQSNSMASQDKYQYIYAQEDVLNS


>TTHERM_00825150(gene)
ATGTCTCTAAAGGAATTTCCTATCATTCAAAAACTAGGCAATTATTTGAAATAAATTACC
ATATTAAGCTAGAAATAATTTATCAGCATATCAAATTATTTTAGAGTATCCTTATGAAAC
CATTAAAATCAGATATAATAATTTTTTGATTTATCAATTTAAAGATACCTCTTCCAAATA
ATTTTATATAGAAAAGATGAAGATTATTCGAAATATATTTTATATTAAAAATGTATTAAA
ATTAATTCATTTAACGAATAGGTGAAGGAGCATATAGTAGTGTATATAAAGTAAAGAGGA
TTAGCGATGATAATGAGTATGCGCTTAAAAAAGTTAAGCTCATGAACCTTTCTGACAAAG
AAAAATAAAATGCTTTGAACGAAGTAAGAATTTTAGCTTCTATTAGATAGCCAAACATAA
TTGGATATAAGGAAGCTTTTGTCGATGAAATGTCAAACTCATTATGGTAAAATTCAATAT
TTTATATAGTCCTGTTAAAACAAAATATTTTTATTTTTTAAAGTATTGTAATGGAGTATG
CAGATAATGGAGATCTCTATTAAAAAATAGTAGAATTTCAAAAAAAAGGATAACTTTTTC
CAGAACAAGAGATATGGCATATTTTTATTTAAGTAGATTTTTATATTTTTTATTTTCTCA
AGAATATAATTTTTAAGAGTAACTCTTAAATTTATCTACTAAAATTAGATTGTCAAAGGC
CTGAAAGCACTTCATAGCTTATAAATATTTCACAGAGATCTCAAGGTTGATAGATAGATT
ATATATTAGTTGATTTGATGATTTTTAAGTTGGGCAATCAATATTTAATTTGATTTTTTC
TTTAAACGGAAAAAACTAAAACATTAAATTTTTTTTGCTTAAATAGAAAAAAAAATTATA
TATATATAAATAATCATTTAAAAACAAAGAAAATAGTAAATTAATTCTTAATTAATATAT
ATATATTATATAAAAATAAGAGCGCAAATGTGTTTCTAACTAAAGAAGGTATTGTTAAGT
TAGGAGATATGAACGTTTCAAAAGTTGCTAAATAAGGATTATTATATACTTAAACGGGTA
CCCCTTACTACGCCAGGTAAAAATAAATAAATGAATATATTTTACTCCTCTTACTCCCTA
AAATAAAACATTTAGAAATATAAATTATTTCATATCTCTTTTAAACATTTATTAGATTTC
TTTTTCTATTTTTAATTTTTCTTAATTTTTTAGAAAGTTTTTAATTTACCTTACTCTATT
AAAAAATAATAAATGCAAATATATAAATATGAGATATAATTTTTCTAACATCGAAATTAA
TTTAGATTGAACTTCATAAGCATTTTAATTTTTTATTTAGTCCAGAAGTGTGGAAAGATT
AAGCATACGACAGTAAATCTGACATTTGGTCATTAGGATGTGTTTTATATGAAATGACTA
CTCTTAAACCACCTTTTAGGGCTGAAGATATGGAAGGTCTTTATAAAAAAGTTATTAGAG
GATACTATCCTAGAATCCCGCCTCATTTCTCTTAAGATCTAGCTAATATTATTAGATCCC
TTTTATAAGTATCCCCTCAATTAAGACCCTCATGTGGTAATTGAAAATGATCAATTTAAC
TTACATTTAATATAATTATTATTTTTTTAGAGTTTTTATTATTTTTAAAACAAAAGATAA
AATTCTTTAAATGCCAGCTGTAATTAAAAGAATGAATGATTCTTTATTAACTGAAGTTGA
CGAAGCAATTTAAAATAACTTGTTGAATACCATAAAAATTCCTAAAAATTTGCATTATCT
TACTGATAGATTACCTAAACCAAATTATGAACCTTTAAAAACTAAGAGAATAGATAAAAG
AAGATTTTTGCAAACTTTAGCAGGGTATACCGATATACCTGATCGTGAATCTCCTTCTCC
GTCTCCAGAATAAATGAAGTAATTGGTACTTCCTAAGATTCCTTAGCAAAGAAAGAATCA
TCATTCTAACAAAAGTAATGAGAACGTGCCACCTAATAATAATCCAAGTTCTATTATTAA
TAATGTGCCAAGCACAACTAGCAACAGAGAAGAAATCGATGAAAGAGGAAGTGAAATAAA
TTAAAATGCATATGATGATTAGTCCTCATAAGTTTCTTTAGCTCATAAGGTTCATCCCAG
AAGCTTATCTAAAAAGCATATTAACAAGTATGAAATCCAATCAAAGTATGATAAATATGG
TCTGGCTTCTCCAAATTACTATCCTGAATCTGTTAAGAGTGATATACATTCAACAAAGCA
CTCAAAACCAATAGACATACTATAGCTTAAAGTAAATATAATCTAAAATTTTTTTGATAT
TTAATTTATGATTATGAAATATAGTAACAATATGAATTAAATAACGACAAATCTCTTCAA
CCAACTTACATTCCAATCAAAAAGAAAAAAGAGCTTTCTCCATTGAAAAAGAAAAAGAAT
TAAGGAATAAATCTATTAGATATTGAAGGAGAGTCCAAGCCACTGCTTTCCAAACAGAGA
AAAAATAATTCTATTGACTAATCTATCATTTATGAAGAGTAAAAATATTTTAAACTTATC
AATTTTTTAAATGATTAACATAATTTAAAATATTAGCCAAAATAATAATGGTAACAGACT
TCCAAACATAAATGGCTCAAAACTACCTAGAATAGGAAATTCGAATAGCGGAAGCACTAA
TAATATGATAGGTGGCGGTGTACTAGGCCTGGGCATAGTAGGAAATGCTGCAAGAAGCCT
AGACAAAGAAAATGCAAAAATTAAAGAAATTACTAAAGCCTACAAAGTAAATTTAGATCC
TATTAATGACTTAAAAGATAGGTACAGATAATTAAAAAAGAATGATAGAACCAAAATTCT
TTCTATCAAGAATGCTAGCATGCCTTAAAGCAATAGTATGGCTTCTTAAGATAAATATTA
GTATATTTATGCTCAGGAAGATGTCTTAAATTCTTGA