Identifiers and Description

Gene Model Identifier

TTHERM_00825150

Standard Name

NRK39 (NIMA-Related Kinase)

Aliases

PreTt03979 | 142.m00076 | 3683.m00009

Description

NRK39 plant dual-specificity MAP kinase kinase family domain protein; NIMA-related kinase; Protein kinase domain containing protein. Sequence similarity to the NEK protein kinase family (Eisen et al.- 2006).

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00825150

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18311.19.997093137033517e-262protein kinase domain-containi
ng protein (649 aa)
OxytrichaContig1689.0.g144.0008150871967356e-141Protein kinase domain
DictyBaseDDB_G02892774.99918933170902e-62nek4 on chromosome: 5 position
2561379 to 2563106
Stentor CoeruleusSteCoe_13442.3455513385429143e-59
WormBaseWBGene000089564.998711177326993e-55locus:nekl-3 status:Confirme
d UniProt:G5EFM9 protein_i
d:CAA92169.2
SGDYAR018C5.000680012816624e-42KIN3 Nonessential serine/threo
nine protein kinase; possible
role in DNA damage response

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00825150(coding)
ATGTCTCTAAAGGAATTTCCTATCATTCAAAAACTAGGTGAAGGAGCATATAGTAGTGTA
TATAAAGTAAAGAGGATTAGCGATGATAATGAGTATGCGCTTAAAAAAGTTAAGCTCATG
AACCTTTCTGACAAAGAAAAATAAAATGCTTTGAACGAAGTAAGAATTTTAGCTTCTATT
AGATAGCCAAACATAATTGGATATAAGGAAGCTTTTGTCGATGAAATGTCAAACTCATTA
TGTATTGTAATGGAGTATGCAGATAATGGAGATCTCTATTAAAAAATAGTAGAATTTCAA
AAAAAAGGATAACTTTTTCCAGAACAAGAGATATGGCATATTTTTATTTAAATTGTCAAA
GGCCTGAAAGCACTTCATAGCTTATAAATATTTCACAGAGATCTCAAGAGCGCAAATGTG
TTTCTAACTAAAGAAGGTATTGTTAAGTTAGGAGATATGAACGTTTCAAAAGTTGCTAAA
TAAGGATTATTATATACTTAAACGGGTACCCCTTACTACGCCAGTCCAGAAGTGTGGAAA
GATTAAGCATACGACAGTAAATCTGACATTTGGTCATTAGGATGTGTTTTATATGAAATG
ACTACTCTTAAACCACCTTTTAGGGCTGAAGATATGGAAGGTCTTTATAAAAAAGTTATT
AGAGGATACTATCCTAGAATCCCGCCTCATTTCTCTTAAGATCTAGCTAATATTATTAGA
TCCCTTTTATAAGTATCCCCTCAATTAAGACCCTCATGTGATAAAATTCTTTAAATGCCA
GCTGTAATTAAAAGAATGAATGATTCTTTATTAACTGAAGTTGACGAAGCAATTTAAAAT
AACTTGTTGAATACCATAAAAATTCCTAAAAATTTGCATTATCTTACTGATAGATTACCT
AAACCAAATTATGAACCTTTAAAAACTAAGAGAATAGATAAAAGAAGATTTTTGCAAACT
TTAGCAGGGTATACCGATATACCTGATCGTGAATCTCCTTCTCCGTCTCCAGAATAAATG
AAGTAATTGGTACTTCCTAAGATTCCTTAGCAAAGAAAGAATCATCATTCTAACAAAAGT
AATGAGAACGTGCCACCTAATAATAATCCAAGTTCTATTATTAATAATGTGCCAAGCACA
ACTAGCAACAGAGAAGAAATCGATGAAAGAGGAAGTGAAATAAATTAAAATGCATATGAT
GATTAGTCCTCATAAGTTTCTTTAGCTCATAAGGTTCATCCCAGAAGCTTATCTAAAAAG
CATATTAACAAGTATGAAATCCAATCAAAGTATGATAAATATGGTCTGGCTTCTCCAAAT
TACTATCCTGAATCTGTTAAGAGTGATATACATTCAACAAAGCACTCAAAACCAATAGAC
ATACTATAGCTTAAATAACAATATGAATTAAATAACGACAAATCTCTTCAACCAACTTAC
ATTCCAATCAAAAAGAAAAAAGAGCTTTCTCCATTGAAAAAGAAAAAGAATTAAGGAATA
AATCTATTAGATATTGAAGGAGAGTCCAAGCCACTGCTTTCCAAACAGAGAAAAAATAAT
TCTATTGACTAATCTATCATTTATGAAGACCAAAATAATAATGGTAACAGACTTCCAAAC
ATAAATGGCTCAAAACTACCTAGAATAGGAAATTCGAATAGCGGAAGCACTAATAATATG
ATAGGTGGCGGTGTACTAGGCCTGGGCATAGTAGGAAATGCTGCAAGAAGCCTAGACAAA
GAAAATGCAAAAATTAAAGAAATTACTAAAGCCTACAAAGTAAATTTAGATCCTATTAAT
GACTTAAAAGATAGGTACAGATAATTAAAAAAGAATGATAGAACCAAAATTCTTTCTATC
AAGAATGCTAGCATGCCTTAAAGCAATAGTATGGCTTCTTAAGATAAATATTAGTATATT
TATGCTCAGGAAGATGTCTTAAATTCTTGA


>TTHERM_00825150(protein)
MSLKEFPIIQKLGEGAYSSVYKVKRISDDNEYALKKVKLMNLSDKEKQNALNEVRILASI
RQPNIIGYKEAFVDEMSNSLCIVMEYADNGDLYQKIVEFQKKGQLFPEQEIWHIFIQIVK
GLKALHSLQIFHRDLKSANVFLTKEGIVKLGDMNVSKVAKQGLLYTQTGTPYYASPEVWK
DQAYDSKSDIWSLGCVLYEMTTLKPPFRAEDMEGLYKKVIRGYYPRIPPHFSQDLANIIR
SLLQVSPQLRPSCDKILQMPAVIKRMNDSLLTEVDEAIQNNLLNTIKIPKNLHYLTDRLP
KPNYEPLKTKRIDKRRFLQTLAGYTDIPDRESPSPSPEQMKQLVLPKIPQQRKNHHSNKS
NENVPPNNNPSSIINNVPSTTSNREEIDERGSEINQNAYDDQSSQVSLAHKVHPRSLSKK
HINKYEIQSKYDKYGLASPNYYPESVKSDIHSTKHSKPIDILQLKQQYELNNDKSLQPTY
IPIKKKKELSPLKKKKNQGINLLDIEGESKPLLSKQRKNNSIDQSIIYEDQNNNGNRLPN
INGSKLPRIGNSNSGSTNNMIGGGVLGLGIVGNAARSLDKENAKIKEITKAYKVNLDPIN
DLKDRYRQLKKNDRTKILSIKNASMPQSNSMASQDKYQYIYAQEDVLNS


>TTHERM_00825150(gene)
ATGTCTCTAAAGGAATTTCCTATCATTCAAAAACTAGGCAATTATTTGAAATAAATTACC
ATATTAAGCTAGAAATAATTTATCAGCATATCAAATTATTTTAGAGTATCCTTATGAAAC
CATTAAAATCAGATATAATAATTTTTTGATTTATCAATTTAAAGATACCTCTTCCAAATA
ATTTTATATAGAAAAGATGAAGATTATTCGAAATATATTTTATATTAAAAATGTATTAAA
ATTAATTCATTTAACGAATAGGTGAAGGAGCATATAGTAGTGTATATAAAGTAAAGAGGA
TTAGCGATGATAATGAGTATGCGCTTAAAAAAGTTAAGCTCATGAACCTTTCTGACAAAG
AAAAATAAAATGCTTTGAACGAAGTAAGAATTTTAGCTTCTATTAGATAGCCAAACATAA
TTGGATATAAGGAAGCTTTTGTCGATGAAATGTCAAACTCATTATGGTAAAATTCAATAT
TTTATATAGTCCTGTTAAAACAAAATATTTTTATTTTTTAAAGTATTGTAATGGAGTATG
CAGATAATGGAGATCTCTATTAAAAAATAGTAGAATTTCAAAAAAAAGGATAACTTTTTC
CAGAACAAGAGATATGGCATATTTTTATTTAAGTAGATTTTTATATTTTTTATTTTCTCA
AGAATATAATTTTTAAGAGTAACTCTTAAATTTATCTACTAAAATTAGATTGTCAAAGGC
CTGAAAGCACTTCATAGCTTATAAATATTTCACAGAGATCTCAAGGTTGATAGATAGATT
ATATATTAGTTGATTTGATGATTTTTAAGTTGGGCAATCAATATTTAATTTGATTTTTTC
TTTAAACGGAAAAAACTAAAACATTAAATTTTTTTTGCTTAAATAGAAAAAAAAATTATA
TATATATAAATAATCATTTAAAAACAAAGAAAATAGTAAATTAATTCTTAATTAATATAT
ATATATTATATAAAAATAAGAGCGCAAATGTGTTTCTAACTAAAGAAGGTATTGTTAAGT
TAGGAGATATGAACGTTTCAAAAGTTGCTAAATAAGGATTATTATATACTTAAACGGGTA
CCCCTTACTACGCCAGGTAAAAATAAATAAATGAATATATTTTACTCCTCTTACTCCCTA
AAATAAAACATTTAGAAATATAAATTATTTCATATCTCTTTTAAACATTTATTAGATTTC
TTTTTCTATTTTTAATTTTTCTTAATTTTTTAGAAAGTTTTTAATTTACCTTACTCTATT
AAAAAATAATAAATGCAAATATATAAATATGAGATATAATTTTTCTAACATCGAAATTAA
TTTAGATTGAACTTCATAAGCATTTTAATTTTTTATTTAGTCCAGAAGTGTGGAAAGATT
AAGCATACGACAGTAAATCTGACATTTGGTCATTAGGATGTGTTTTATATGAAATGACTA
CTCTTAAACCACCTTTTAGGGCTGAAGATATGGAAGGTCTTTATAAAAAAGTTATTAGAG
GATACTATCCTAGAATCCCGCCTCATTTCTCTTAAGATCTAGCTAATATTATTAGATCCC
TTTTATAAGTATCCCCTCAATTAAGACCCTCATGTGGTAATTGAAAATGATCAATTTAAC
TTACATTTAATATAATTATTATTTTTTTAGAGTTTTTATTATTTTTAAAACAAAAGATAA
AATTCTTTAAATGCCAGCTGTAATTAAAAGAATGAATGATTCTTTATTAACTGAAGTTGA
CGAAGCAATTTAAAATAACTTGTTGAATACCATAAAAATTCCTAAAAATTTGCATTATCT
TACTGATAGATTACCTAAACCAAATTATGAACCTTTAAAAACTAAGAGAATAGATAAAAG
AAGATTTTTGCAAACTTTAGCAGGGTATACCGATATACCTGATCGTGAATCTCCTTCTCC
GTCTCCAGAATAAATGAAGTAATTGGTACTTCCTAAGATTCCTTAGCAAAGAAAGAATCA
TCATTCTAACAAAAGTAATGAGAACGTGCCACCTAATAATAATCCAAGTTCTATTATTAA
TAATGTGCCAAGCACAACTAGCAACAGAGAAGAAATCGATGAAAGAGGAAGTGAAATAAA
TTAAAATGCATATGATGATTAGTCCTCATAAGTTTCTTTAGCTCATAAGGTTCATCCCAG
AAGCTTATCTAAAAAGCATATTAACAAGTATGAAATCCAATCAAAGTATGATAAATATGG
TCTGGCTTCTCCAAATTACTATCCTGAATCTGTTAAGAGTGATATACATTCAACAAAGCA
CTCAAAACCAATAGACATACTATAGCTTAAAGTAAATATAATCTAAAATTTTTTTGATAT
TTAATTTATGATTATGAAATATAGTAACAATATGAATTAAATAACGACAAATCTCTTCAA
CCAACTTACATTCCAATCAAAAAGAAAAAAGAGCTTTCTCCATTGAAAAAGAAAAAGAAT
TAAGGAATAAATCTATTAGATATTGAAGGAGAGTCCAAGCCACTGCTTTCCAAACAGAGA
AAAAATAATTCTATTGACTAATCTATCATTTATGAAGAGTAAAAATATTTTAAACTTATC
AATTTTTTAAATGATTAACATAATTTAAAATATTAGCCAAAATAATAATGGTAACAGACT
TCCAAACATAAATGGCTCAAAACTACCTAGAATAGGAAATTCGAATAGCGGAAGCACTAA
TAATATGATAGGTGGCGGTGTACTAGGCCTGGGCATAGTAGGAAATGCTGCAAGAAGCCT
AGACAAAGAAAATGCAAAAATTAAAGAAATTACTAAAGCCTACAAAGTAAATTTAGATCC
TATTAATGACTTAAAAGATAGGTACAGATAATTAAAAAAGAATGATAGAACCAAAATTCT
TTCTATCAAGAATGCTAGCATGCCTTAAAGCAATAGTATGGCTTCTTAAGATAAATATTA
GTATATTTATGCTCAGGAAGATGTCTTAAATTCTTGA