Identifiers and Description

Gene Model Identifier

TTHERM_00473180

Standard Name

NRK37 (NIMA-Related Kinase )

Aliases

PreTt02218 | 57.m00157 | 3709.m00018

Description

NIMA-Related Kinase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00473180

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18311.12.9988601762256104e-132protein kinase domain-containi
ng protein (649 aa)
OxytrichaContig2600.0.g1052.0004261429631518e-110Protein kinase domain
DictyBaseDDB_G02708141.0001055852164665e-60nek2 on chromosome: 1 position
4847143 to 4848761
Stentor CoeruleusSteCoe_360254.1863939993042314e-51
WormBaseWBGene000214614.001501063932074e-49locus:nekl-1 status:Partiall
y_confirmed UniProt:Q6AW07
protein_id:CCD69902.1
SGDYAR018C1.9991939848149086e-44KIN3 Nonessential serine/threo
nine protein kinase; possible
role in DNA damage response

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16611747: Wloga D, Camba A, Rogowski K, Manning G, Jerka-Dziadosz M, Gaertig J (2006) Members of the NIMA-related kinase family promote disassembly of cilia by multiple mechanisms. Molecular biology of the cell 17(6):2799-810

Sequences

>TTHERM_00473180(coding)
ATGGGATAGGAATTAAGAGATTTTGAAATTTTAGATAAATTAGGAGAAGGAGCATACAGT
TCTGTTTATAAAGTTAAGCGGTAGTCAGATGGTAAAATATATGCGCTAAAGAGAGTAATG
CTAGGTACATTAACTGAATAAGAAAAACAAAATGCATTAAATGAAGTCAGGATTATTGCT
TCTATCCGTCATCCAAATATAGTGAATTTCAAACAATGCTTTATAGACACACACTTAAAT
TGTTTATGTATTATCATGGAGTATGTAGATAACGGGGATTTACTATCTCATATTAACAAG
CACATTAAGAACGGTACTTACTTTTAAGAGGAAGAGATTTGGAATGTATTAATATAAGTT
GTAAAGGGATTACAGAGCCTCCATTAATTGAGCATTTATCATCGAGACTTGAAAAGTGCA
AATGTGTTTATGAATAAAGACGGTTCTATTAAGTTAGGTGATTTTAATGTTTCTAAAATA
TGTAAATAAGGTCTTTTGTACACTTAGACGGGTACGCCTTATTATGCAAGTCCTGAAGTT
TGGAGGGATTTACCATATGATAGCAAGGCAGATATATGGTCTGTTGGTTGCGTGATATAT
GAAATTTGTGCATTAAAACCCCCATTTAGAGCAGAAAATATGCCTTCTTTGTTTAAAAAA
GTAGTGAAAGGATAGTACCAAAAAATACCTTCTTTTTATTCTCAGTAGTTGAGCTAAATA
ATTAGATAAATGCTTTAAGTGTCTCCTCATTTACGTCCTAGCTGCAAAAAAATATTAGAA
GATGAAGTAGTATAAAAACATATGAATGATAAACATCTTGAAGAACCAGATGAACAAGAA
AGATCTATCCTTATAAATACAATAAAATTTCCTTAGGCTTTTAAAAATAAATATGCTAAA
ATAGAATTTCCAAAACCTAATTATCACCCTGTAAAAATAAGAAAAAGAATTTCAAGCAAC
ACCCGCTTGATAACAACTTTTGATTAAAGTGAATCCATTCTCTAATGCACTAACAAGAGC
ATGATAGAAGAATCATCTCATAAAATGCTCACAGAAAATTCTACTCATTAACCACCTTCA
AGCTAAAGACATCACTCTTAAAGATAAATATAAAACGAAGCTAGTATACTTTCAATGATA
GGTATTGAAAATACTAATATTAATTCTCATAGATAACAAAAGATAAATAAAAAAAATAGC
TATTGTTTATAACAATAAGATAAAATAGAATTATAAGAGGGAATTCAATAAAATAAAAAA
GATTATATAAATATTAACTAGCATGTAAATTATATCTAATAAATTGATAAAATAAGCAAC
ATAGAATTGAATGACTAGCTATTAGCCTCGTCTTAATCAAAAAAAAAAACAAATGCTTCT
CAATAGAATATTAATGGTTTAAATCAACAAAATATTATTCAAGGAAATTAACATAATGAA
GATTTATTTAGTGAATATTAGTCCAAAGCACTTATTATAGACAATTCTAAGAGTGTTTCT
CTTGCAGATGGTGAAAGAAAGATATAAAAATAGAGTATTTCAACAAATGAGAGCCGAAGA
AAATCTATTCATGCTAGATAATCAAGTAGTCTATCATCATAAGTTCAACCAAAAAATTAT
TCTTCAATAAATAAATAAAAATAGCTTTACAAAATATTAAAACAACCAATCAGCATAGTT
AAATAAATTCAACAATAACAATCACCATCTATAAATAATTAAAATGCTTAAACGAATTAG
AATATCATTAATTCATATAATAACAGTTTATTACTAAATTAATCTATAAACAATTAATAA
TATCCATAAAAAAATATTATCAAAAACCAAAGCATTTCATCTGTTTTAAGGGAAAGTTTG
ATTGCTCTAGAGAAAGATATAGCCAAAAGCACGAAAGGCTAAAGAGCCTCTATATAATAA
AACGATAGTAAAGAAATTAGCCATGCTAAAGGAGAATAAATTTAAAGAGATAATGAAAAG
TAAGTCTCAGTAAGTTATTCACGCTCTCACAAAAATTCTTATCACGTAGCACCTGATGGA
GTTCAAAAAAATGAAGAGGATTTTATAAATGGATAGTTGGACTCTATAGCATAATAAAAT
AAAATACAAAGTTATAAAGATAGAAATATTATACCAGATAAAGAAAATTTAAATGATATC
TAATATGTCTCCTAATTATAAACTACTTCTAAAACTACAAAAAACATGAAATAAAATTCT
AAATTAAATTATGAAAAAAGTAAAAGTAGAGAAATTAATCAAAATAGATAAAGCACACAT
TTGTAAGTAATATAAAATGGCTAAGTGAATTAGCACAGAATACCCACGCTATATGAATTA
GATAAATCTCCTGTAGCATATAATGAAGGAAGAAAAAAGAGTAAATCAATTTTCGAAAAA
AACAGTACAACAGTTACAGTCCCTGACTAATACATGAATTTAGAATATAAATATAAAAAA
GAGAAAATGTTAGAAAGCTCCTCAAGACAATAAATAGATAATAATGAAAACACTGAAAAT
ATATTAATAAAAAAACAAATTAAATATTCTGGTGAAACTCCTGAAAAGTTAATAATTCTA
CCAATAATTAACCCTGTTAAAAATACTAAATAAGATAGAAGTATTTCGGTTTAGAGAAAA
TACAGTCCAATATATTCACAAAATAATAACAGGGAAAATATTTTAAATAGGAATGGGCAC
ATATTTTAAGAAAACGATGTTAAAAAGAAGTTACTTTATAATGAAAATGAATAAAAAATA
TTAGATCCAAGTTAAATGCATTTAAATTAAAATAACTTATACATAAATAGTCACAAATAA
AATTACTACCACAATAAGGTCTCTTATTAGCAAACTCCTTTAGCATAAGATAAATATAAT
ATTTAATTAGATATGGAAACAATTGGTAATTATAAAAGAATCCATAGTAATTCAATCAAA
CCTGCACATAAAAATTCTCTATCTCCTTAGAATTACAGAAACAACCAGCAAAGATTAATT
TGA


>TTHERM_00473180(protein)
MGQELRDFEILDKLGEGAYSSVYKVKRQSDGKIYALKRVMLGTLTEQEKQNALNEVRIIA
SIRHPNIVNFKQCFIDTHLNCLCIIMEYVDNGDLLSHINKHIKNGTYFQEEEIWNVLIQV
VKGLQSLHQLSIYHRDLKSANVFMNKDGSIKLGDFNVSKICKQGLLYTQTGTPYYASPEV
WRDLPYDSKADIWSVGCVIYEICALKPPFRAENMPSLFKKVVKGQYQKIPSFYSQQLSQI
IRQMLQVSPHLRPSCKKILEDEVVQKHMNDKHLEEPDEQERSILINTIKFPQAFKNKYAK
IEFPKPNYHPVKIRKRISSNTRLITTFDQSESILQCTNKSMIEESSHKMLTENSTHQPPS
SQRHHSQRQIQNEASILSMIGIENTNINSHRQQKINKKNSYCLQQQDKIELQEGIQQNKK
DYININQHVNYIQQIDKISNIELNDQLLASSQSKKKTNASQQNINGLNQQNIIQGNQHNE
DLFSEYQSKALIIDNSKSVSLADGERKIQKQSISTNESRRKSIHARQSSSLSSQVQPKNY
SSINKQKQLYKILKQPISIVKQIQQQQSPSINNQNAQTNQNIINSYNNSLLLNQSINNQQ
YPQKNIIKNQSISSVLRESLIALEKDIAKSTKGQRASIQQNDSKEISHAKGEQIQRDNEK
QVSVSYSRSHKNSYHVAPDGVQKNEEDFINGQLDSIAQQNKIQSYKDRNIIPDKENLNDI
QYVSQLQTTSKTTKNMKQNSKLNYEKSKSREINQNRQSTHLQVIQNGQVNQHRIPTLYEL
DKSPVAYNEGRKKSKSIFEKNSTTVTVPDQYMNLEYKYKKEKMLESSSRQQIDNNENTEN
ILIKKQIKYSGETPEKLIILPIINPVKNTKQDRSISVQRKYSPIYSQNNNRENILNRNGH
IFQENDVKKKLLYNENEQKILDPSQMHLNQNNLYINSHKQNYYHNKVSYQQTPLAQDKYN
IQLDMETIGNYKRIHSNSIKPAHKNSLSPQNYRNNQQRLI


>TTHERM_00473180(gene)
ATGGGATAGGAATTAAGAGATTTTGAAATTTTAGATAAATTAGGTAAAATTGGATTTGAA
TTTGCATATTTTATACCAGCTCTCATTAGATATAAAGAAAAACTAATTACATTACTGTTA
ATTATTAGGAGAAGGAGCATACAGTTCTGTTTATAAAGTTAAGCGGTAGTCAGATGGTAA
AATATATGCGCTAAAGAGAGTAATGCTAGGTACATTAACTGAATAAGAAAAACAAAATGC
ATTAAATGAAGTCAGGATTATTGCTTCTATCCGTCATCCAAATATAGTGAATTTCAAACA
ATGCTTTATAGACACACACTTAAATTGTTTATGGTAATAGCAAAAAATCCATTACAACAA
GATAACAATTATCATTGAATTAGCAAATATAAATTAAATATTCACAAGAAAAATGATAAT
ATAATTTTAAAAATGTTTACTCAAATCAGAATTTATTCAAATTTTAAAATAATTTTTTCC
AATATTAGTATTAATAATATTTGGTATTAAATAGTATTATCATGGAGTATGTAGATAACG
GGGATTTACTATCTCATATTAACAAGCACATTAAGAACGGTACTTACTTTTAAGAGGAAG
AGATTTGGAATGTATTAATATAAGTAATTATAAATGTTAAATTCTAAATGAAAATTGATT
GTATTATTTATTTTTTAAAGCAAAATATTTTTCTATTTTATATTGAATTTATGAACTTAA
ATAAATTCAGGTTGTAAAGGGATTACAGAGCCTCCATTAATTGAGCATTTATCATCGAGA
CTTGAAAGTTGATTATTTTTTTACTTTTAAACTACTAATAACCATTCAAATCAAATTAAA
AGAAGACAATTATTTTTTAATTTAATTTTGTTGTAATATCTTTAAGAGTGCAAATGTGTT
TATGAATAAAGACGGTTCTATTAAGTTAGGTGATTTTAATGTTTCTAAAATATGTAAATA
AGGTCTTTTGTACACTTAGACGGGTACGCCTTATTATGCAAGGTAATATTAAATGAGTAA
AAATAATTAAGAGTAAACTAATTTGATTGATTATAAATATAGTCCTGAAGTTTGGAGGGA
TTTACCATATGATAGCAAGGCAGATATATGGTCTGTTGGTTGCGTGATATATGAAATTTG
TGCATTAAAACCCCCATTTAGAGCAGAAAATATGCCTTCTTTGTTTAAAAAAGTAGTGAA
AGGTATGATTGTTTTTAGATTATTTGAAAAATTTAATTTTTTTCTTTCTAGGATAGTACC
AAAAAATACCTTCTTTTTATTCTCAGTAGTTGAGCTAAATAATTAGATAAATGCTTTAAG
TGTCTCCTCATTTACGTCCTAGCTGCAGTAAGTTTTTGATATTAATAAAATACCTAAAAA
TAATTTTATCATTATAAAAAAAGAAAAAATATTAGAAGATGAAGTAGTATAAAAACATAT
GAATGATAAACATCTTGAAGAACCAGATGAACAAGAAAGATCTATCCTTATAAATACAAT
AAAATTTCCTTAGGCTTTTAAAAATAAATATGCTAAAATAGAATTTCCAAAACCTAATTA
TCACCCTGTAAAAATAAGAAAAAGAATTTCAAGCAACACCCGCTTGATAACAACTTTTGA
TTAAAGTGAATCCATTCTCTAATGCACTAACAAGAGCATGATAGAAGAATCATCTCATAA
AATGCTCACAGAAAATTCTACTCATTAACCACCTTCAAGCTAAAGACATCACTCTTAAAG
ATAAATATAAAACGAAGCTAGTATACTTTCAATGATAGGTATTGAAAATACTAATATTAA
TTCTCATAGATAACAAAAGATAAATAAAAAAAATAGCTATTGTTTATAACAATAAGATAA
AATAGAATTATAAGAGGGAATTCAATAAAATAAAAAAGATTATATAAATATTAACTAGCA
TGTAAATTATATCTAATAAATTGATAAAATAAGCAACATAGAATTGAATGACTAGCTATT
AGCCTCGTCTTAATCAAAAAAAAAAACAAATGCTTCTCAATAGAATATTAATGGTTTAAA
TCAACAAAATATTATTCAAGGAAATTAACATAATGAAGATTTATTTAGTGAATATTAGTC
CAAAGCACTTATTATAGACAATTCTAAGAGTGTTTCTCTTGCAGATGGTGAAAGAAAGAT
ATAAAAATAGAGTATTTCAACAAATGAGAGCCGAAGAAAATCTATTCATGCTAGATAATC
AAGTAGTCTATCATCATAAGTTCAACCAAAAAATTATTCTTCAATAAATAAATAAAAATA
GCTTTACAAAATATTAAAACAACCAATCAGCATAGTTAAATAAATTCAACAATAACAATC
ACCATCTATAAATAATTAAAATGCTTAAACGAATTAGAATATCATTAATTCATATAATAA
CAGTTTATTACTAAATTAATCTATAAACAATTAATAATATCCATAAAAAAATATTATCAA
AAACCAAAGCATTTCATCTGTTTTAAGGGAAAGTTTGATTGCTCTAGAGAAAGATATAGC
CAAAAGCACGAAAGGCTAAAGAGCCTCTATATAATAAAACGATAGTAAAGAAATTAGCCA
TGCTAAAGGAGAATAAATTTAAAGAGATAATGAAAAGTAAGTCTCAGTAAGTTATTCACG
CTCTCACAAAAATTCTTATCACGTAGCACCTGATGGAGTTCAAAAAAATGAAGAGGATTT
TATAAATGGATAGTTGGACTCTATAGCATAATAAAATAAAATACAAAGTTATAAAGATAG
AAATATTATACCAGATAAAGAAAATTTAAATGATATCTAATATGTCTCCTAATTATAAAC
TACTTCTAAAACTACAAAAAACATGAAATAAAATTCTAAATTAAATTATGAAAAAAGTAA
AAGTAGAGAAATTAATCAAAATAGATAAAGCACACATTTGTAAGTAATATAAAATGGCTA
AGTGAATTAGCACAGAATACCCACGCTATATGAATTAGATAAATCTCCTGTAGCATATAA
TGAAGGAAGAAAAAAGAGTAAATCAATTTTCGAAAAAAACAGTACAACAGTTACAGTCCC
TGACTAATACATGAATTTAGAATATAGTAAATTAATTAATTATTTTAACTTTATCTCTTT
TTCATTTTTTTTGAATAATAAAAGAATATAAAAAAGAGAAAATGTTAGAAAGCTCCTCAA
GACAATAAATAGATAATAATGAAAACACTGAAAATATATTGTAAAATATTAATTTATTTT
CTATTTTTCATATAAAAAATTTAATATTTAAATTAGAATAAAAAAACAAATTAAATATTC
TGGTGAAACTCCTGAAAAGTTAATAATTCTACCAATAATTAACCCTGTTAAAAATACTAA
ATAAGATAGAAGTATTTCGGTTTAGAGAAAATACAGTCCAATATATTCACAAAATAATAA
CAGGGAAAATATTTTAAATAGGAATGGGCACATATTTTAAGAAAACGATGTTAAAAAGAA
GTTACTTTATAATGAAAATGAATAAAAAATATTAGATCCAAGTTAAATGCATTTAAATTA
AAATAACTTATACATAAATAGTCACAAATAAAATTACTACCACAATAAGGTCTCTTATTA
GCAAACTCCTTTAGCATAAGATAAATATAATATTTAATTAGATATGGAAACAATTGGTAA
TTATAAAAGAATCCATAGTAATTCAATCAAACCTGCACATAAAAATTCTCTATCTCCTTA
GAATTACAGAAACAACCAGCAAAGATTAATTTGA