Identifiers and Description

Gene Model Identifier

TTHERM_00525110

Standard Name

NRK36 (NIMA-Related Kinase )

Aliases

PreTt06348 | 66.m00147 | 3722.m00006

Description

NIMA-Related Kinase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF03281 ) Mab-21 protein
  • ( TIGR01612 ) rhoptry protein
  • ( PF02363 ) Cysteine rich repeat
  • ( PF00069 ) protein kinase domain
  • ( TIGR01257 ) rim ABC transporter
  • ( PF08792 ) A2L zinc ribbon domain
  • ( PF07714 ) protein tyrosine kinase
  • ( PF06827 ) Zinc finger found in FPG
  • ( PF04547 ) Protein of unknown function, DUF590
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF00053 ) Laminin EGF-like (Domains III and
  • ( PF03302 ) Giardia variant-specific surface protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.7%

TetraMine Data

TTHERM_00525110

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13359.19.997093137033517e-262hypothetical protein (1345 aa)
Stentor CoeruleusSteCoe_303581.5628821893349888e-18
OxytrichaContig20768.0.1.g690.00000000000004998767099442072Calcium-activated chloride cha
nnel
WormBaseWBGene000133260.00000005001214305021125locus:anoh-2 Anoctamin sta
tus:Partially_confirmed UniP
rot:H2L2L3 protein_id:CCE716
92.1
DictyBaseDDB_G02677520.0000020007268868677913DDB_G0267752 on chromosome: 1
position 783552 to 786233

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16611747: Wloga D, Camba A, Rogowski K, Manning G, Jerka-Dziadosz M, Gaertig J (2006) Members of the NIMA-related kinase family promote disassembly of cilia by multiple mechanisms. Molecular biology of the cell 17(6):2799-810

Sequences

>TTHERM_00525110(coding)
ATGGCTGATAAGAACATAGTCAATGATGCTGTTAATCAACAAACTGTGATACAACCGAAT
GAATAGCCTGATGTTTAAAATTAGCAAACATTCACCACAAAGAAAAAGGATAATAAAGAT
AAGGGTTATCCACCAGATTATAGAAGGAGAAGAATCAATAAAATGAAATAGATAGAAAAG
TTTTTGATAGAAGAAGAGATATATTAGCATGTTGATACAAGTTTTTAGGCAGATGTTAAA
TATTTAGATGAACTTGATTACCACTTGGGTGATTTTGTTTTTAAATTAAGAAACCCAGAT
CATCCTAATTTTGAATATAACAAAGAATCCTAGTTACAAATATAAAAATTAATTGATAAC
TCTTTATAGAAAAAAAAACCTTCTTAAATGAAGTTCAGTCAATTATCAAAAATGGCTGAT
TTAATTCTGCATGCAGACACTCCATTTGAAACAGTTAGGTCAGAAAACCACTTAATTAAT
TTAGCTTTATTTAGAGTATTCAAAAGAATTTATGACTATGTCAAACTTCGTGATGATCCA
AATCAAGAAGAATATAATTTACTTAAAGAGAAATATTAAGAATAAAATGAAAAATAATTT
ATGATTAAGTACACTCTTGATAATCTTGGTGTTTTCGAAACAATACCCAAGCCTCCAAAA
GATAGAAAAAAAAATAGGCAATATAAAAAAGCGAATATGATAGTAGACGATGAAGGTTAT
GCAAACACTTTGAAAAACGATATAAAAATACCTATTGCCAATATGGCTGGAGAGGGTAAA
GTTGATTAGAGAGTCCCTTATTTAAGAAAAGATTAAAGTGGAAAGTGGGTTAGAACTGAT
AATCCTGTTTCTGATTTTACTACACTTTTCAGGAATTATTTGATTTATAAATTAGCAGTT
TAGGGTGGATTTAAATTGAGATAGTTTATTTCTTAAAGTGGAGAGTTTTTTTATATTGTT
CTTTATACATCTTTCGAAAATTTAAAAGCCCAAGCCTCAATTATGAGTTTGAATAAAACA
TTTTCTTTAACTCAGACAGATATTTTCTCTTTAGAGCCAGTTGACTCTAGAATGAGACCT
CTTCGTTTGAATCATCAATTAAGACTCCTTACTCCCCAAGTTAAAGACGGAGATCCTGCA
AAGCTATAACTAGTTAGGGAAGAAAGAGAGTAAAGAGAAAAATTGAAAGATGATTTAGTA
AAAGGAAGATACAAGAAGGAGTTAGAAAAGCAAATGTTAAAATATAAAGGCCATAGATTT
ATTTCAGATGAAGACTATTCAAAATTAATTGATATTAGTGTTAAAACAATAGTACTTTCT
GAAATTCAAATAGATAAATACATTGACATTAAAATGGAAAAAAATAAATTAAACGTTTTT
TATGAAGATGATAGAAAAATTTTATTGTAAAAATAAAAAGTTTTAGGAGAAACCATTACA
AATGAAAGAATTAAAATTAAAAAATAAATTGTTAAGGATATTGAAAATATTCCTCTACTT
TAACACTCTGCATTCGCTCGTAAATATATTAATAATAAGGGACCAAGCATAAGCAAATTC
AGCAAATAATTCTTTGAAACAAAGCTAAAAATTCTAGAACTTCTCTTTCATATTGATTTT
AAATTGCTTTAATTTGAGTGTGGCTCTTCTTAACTTCAAACAAAAGAAGAAATTCAAGAA
AATAATGAAGAATCATACAATACTTACTTAGGATATCTAAGCTATCTTGAGAAACTTAAT
GAACTCATTTAAAAAGTAAGAGAAAAGTATAGAGACAAAGAGGAGTATGAAATCGATTCA
TACACACTTAAATAGATTTTAGATACAAAGAGACCTATTGAATTAAAGTCGTTGTTAGGT
AGAAATAAGAAAAAACAAAAAACATATGTTGTGAAGAAGATTAAGACTACTCCAAATGAA
TAAGCACTAGAAATACATATTCCTGCAGCTAATTGGAAAAAGTACATTTATGGAAATATG
CAGCAAGAGATTTATGAAGCATTTACTTTAGCTCTTAGAAGAGCTCAGAAAGGCCCAAAT
GGTAGGAATATTAAGACTATTTGGGATTATTAAGGATAATCAGTTTAGCAAATATTTTCT
GATTATATTTACGTACCAAGCTCTAAAAGAATTCGCAATAAAATTCTTCTAGAAAATTGC
TGGCAAAGATAGCCAATAAACTTAAATGAAAAAATGGAAATATTCAACAAGATGGAAAGA
ATAAAGATTACTACTTCTTTATTAGTTAGCTTGCTTGATTTTTCAAAGCTCAAAACTCAA
GAAGACCTCATTTACGATTACTTCCCATTGCATGATAAATACTTGCTTTTTGGGTAACGT
GAACACTCTGATATTTTTAGGAGGATTATATAAGAAAAGATAAAATAAGATTACCCAAAC
GAAGAGGATTATAAATTTTAGATAATTAATTCTGATAAACATTATGAGTTATAAATAAAA
AATTACTAAATGATTACAGATTTATGCTTATTACCAAATTGGAATCCTTTGTTGATATAT
AATGTTCCTGAATAAGAAATTTGTGAATATTTTGGAGAAAGAATTGCTCTTTATTTTACT
TTCCAAAGCTTTTATTTCAAAGCTCAGTTTTCTGTTGCTTTATTAAGTACTCCAATTTTC
ATCGTTTATGAGTATTTTGGTCAAACAGATAAAGGATTAGGTGCTCAAATAGCTGGTTTG
ATCCATATATTTATTGTTGTTATATGGTCAAATGTATTTTATGGACAATGGACTTATAGA
GAAGCAGAATTTTCTTTAAAGTACAACCAATCTCAAAGTGGTGAAGATGAAGAAGATATA
AGACCTGGTTTTAGAGGCGAATACGAACGTTCAATTACATCAAACAAGTTGAATGATTAC
AGTTATGACAGAAGATTAACTGAAAAATCTGAAAGAAACTATTGGATTTTAATATTTTTT
ATACTAATAGTAAACATAGTTATTATTTACGCTCTTATATACTTGTAATCTTACTTTGAC
GATCACAACACAATAGACTCTGGAAAAACTTTTATGGGATTGAACATATTTATTCCTACA
ATAATTCTTGAGTTCATCTTCTGGGTTGAAGAATTCCTCTTTAAGAAATTTGCCTTATTC
ACCTGCAGAGAAGCTAATTTCAAAACAACAAAGGAATTTGAATAAAGCTATTCAACCAAA
TTGTTTACTTTTATATTCTTTAACCACTTAGTCCCTCCTACTTTGATTTCGTTTATCATA
GATCAAAACATAGGTTGTGTGTAGGATGATTGCTCTTATCATCTCTCTGTTTATATTAGA
TCATATTAGTACATCATAGTATTTAAAAGTATAGTTGAAATAATTTATCCTTTACTTAGA
AGCTCTCTTAATAATGTCACTCAGTTAGTTAAATAGCTAGTTAACAAAGATGTAGATCAA
AAGTAGTAATATCTCTTCGATCATGTTAATATAGAAATCGAGAACCAATCAGGATTAATG
GACAGTGTGATAGATGAAATAGATCAGCCAACAAGAGATTATATTGAAATGTTTACCTAT
TATTGCTTTAATGTTACTTATGGATTTGGTTTTCCTCTTGTTTTTGCTATAACTTTTGGA
ATCACATTTATTAAAATGATTGTCACTAGAAGACTTTTTACAAGAAGAATCAAGAGACCT
AATCCATAAAATGCTTCTACAATAGGTATTTTCAGGCAATTTATGAATTTAGGTTCTTCG
TTATCTATTCTTACATACACTGGTATATTCTGCTTCACAAGAAGCCAAAAGCCTGACTGG
GGTCCTTTCACTCAACTTAATGCATTTATGTTTATTTCATTTTTCTTCTTTGTCGTGAAA
TTCTTTATTGATAGATATTACTCTGAACTCGATTCCAAGACTATGGATATTTTAAAAAGA
CAGGCATTTATCAGAGACAATTACAACCTTAAAAATAATCTATCTGGACCATCTACAAAG
GTAGTAGAGTCTAATCCTTTCTTTAAAGTATATGGTACATATCTAGAAGATAAAACAGAG
CAATTAAAGAAAAATAATTGA


>TTHERM_00525110(protein)
MADKNIVNDAVNQQTVIQPNEQPDVQNQQTFTTKKKDNKDKGYPPDYRRRRINKMKQIEK
FLIEEEIYQHVDTSFQADVKYLDELDYHLGDFVFKLRNPDHPNFEYNKESQLQIQKLIDN
SLQKKKPSQMKFSQLSKMADLILHADTPFETVRSENHLINLALFRVFKRIYDYVKLRDDP
NQEEYNLLKEKYQEQNEKQFMIKYTLDNLGVFETIPKPPKDRKKNRQYKKANMIVDDEGY
ANTLKNDIKIPIANMAGEGKVDQRVPYLRKDQSGKWVRTDNPVSDFTTLFRNYLIYKLAV
QGGFKLRQFISQSGEFFYIVLYTSFENLKAQASIMSLNKTFSLTQTDIFSLEPVDSRMRP
LRLNHQLRLLTPQVKDGDPAKLQLVREEREQREKLKDDLVKGRYKKELEKQMLKYKGHRF
ISDEDYSKLIDISVKTIVLSEIQIDKYIDIKMEKNKLNVFYEDDRKILLQKQKVLGETIT
NERIKIKKQIVKDIENIPLLQHSAFARKYINNKGPSISKFSKQFFETKLKILELLFHIDF
KLLQFECGSSQLQTKEEIQENNEESYNTYLGYLSYLEKLNELIQKVREKYRDKEEYEIDS
YTLKQILDTKRPIELKSLLGRNKKKQKTYVVKKIKTTPNEQALEIHIPAANWKKYIYGNM
QQEIYEAFTLALRRAQKGPNGRNIKTIWDYQGQSVQQIFSDYIYVPSSKRIRNKILLENC
WQRQPINLNEKMEIFNKMERIKITTSLLVSLLDFSKLKTQEDLIYDYFPLHDKYLLFGQR
EHSDIFRRIIQEKIKQDYPNEEDYKFQIINSDKHYELQIKNYQMITDLCLLPNWNPLLIY
NVPEQEICEYFGERIALYFTFQSFYFKAQFSVALLSTPIFIVYEYFGQTDKGLGAQIAGL
IHIFIVVIWSNVFYGQWTYREAEFSLKYNQSQSGEDEEDIRPGFRGEYERSITSNKLNDY
SYDRRLTEKSERNYWILIFFILIVNIVIIYALIYLQSYFDDHNTIDSGKTFMGLNIFIPT
IILEFIFWVEEFLFKKFALFTCREANFKTTKEFEQSYSTKLFTFIFFNHLVPPTLISFII
DQNIGCVQDDCSYHLSVYIRSYQYIIVFKSIVEIIYPLLRSSLNNVTQLVKQLVNKDVDQ
KQQYLFDHVNIEIENQSGLMDSVIDEIDQPTRDYIEMFTYYCFNVTYGFGFPLVFAITFG
ITFIKMIVTRRLFTRRIKRPNPQNASTIGIFRQFMNLGSSLSILTYTGIFCFTRSQKPDW
GPFTQLNAFMFISFFFFVVKFFIDRYYSELDSKTMDILKRQAFIRDNYNLKNNLSGPSTK
VVESNPFFKVYGTYLEDKTEQLKKNN


>TTHERM_00525110(gene)
ATGGCTGATAAGAACATAGTCAATGATGCTGTTAATCAACAAACTGTGATACAACCGAAT
GAATAGCCTGATGTTTAAAATTAGCAAACATTCACCACAAAGAAAAAGGATAATAAAGAT
AAGGGTTATCCACCAGATTATAGAAGGAGAAGAATCAATAAAATGAAATAGATAGAAAAG
TTTTTGATAGAAGAAGAGATATATTAGCATGTTGATACAAGTTTTTAGGCAGATGTTAAA
TATTTAGATGAACTTGATTACCACTTGGGTGATTTTGTTTTTAAATTAAGAAACCCAGAT
CATCCTAATTTTGAATATAACAAAGAATCCTAGTTACAAATATAAAAATTAATTGATAAC
TCTTTATAGAAAAAAAAACCTTCTTAAATGAAGTTCAGTCAATTATCAAAAATGGCTGAT
TTAATTCTGCATGCAGACACTCCATTTGAAACAGTTAGGTCAGAAAACCACTTAATTAAT
TTAGCTTTATTTAGAGTATTCAAAAGAATTTATGACTATGTCAAACTTCGTGATGATCCA
AATCAAGAAGAATATAATTTACTTAAAGAGAAATATTAAGAATAAAATGAAAAATAATTT
ATGATTAAGTACACTCTTGATAATCTTGGTGTTTTCGAAACAATACCCAAGCCTCCAAAA
GATAGAAAAAAAAATAGGCAATATAAAAAAGCGAATATGATAGTAGACGATGAAGGTAAT
AAATTAACTATTTTTTTGTATATTTATCTACCCAAAGTTATTAATAAATAGAATTTAAAA
TTTATATTAATTATTTGCGGCTAAGTAAAGTATTTAAAATAATATTTAAATCTATTTATT
TAGTTTTTTAATATTTTATTTTATTTCGGAATGATACAAATTAGCTTTAAAAATTTGAAA
TTCAAAAAAAAAAAGTTTTAAGCAAGAAACAAATCTAAAAATAAAAAAATAATATTTAAT
AAGAATTTTATCATGCTTTATAATTTTATTAAATAATAATACTTAGGTTATGCAAACACT
TTGAAAAACGATATAAAAATACCTATTGCCAATATGGCTGGAGAGGGTAAAGTTGATTAG
AGAGTCCCTTATTTAAGAAAAGATTAAAGTGGAAAGTGGGTTAGAACTGATAATCCTGTT
TCTGATTTTACTACACTTTTCAGGAATTATTTGATTTATAAATTAGCAGTTTAGGGTGGA
TTTAAATTGAGATAGTTTATTTCTTAAAGTGGAGAGTTTTTTTATATTGTTCTTTATACA
TCTTTCGAAAATTTAAAAGCCCAAGCCTCAATTATGAGTTTGAATAAAACATTTTCTTTA
ACTCAGACAGATATTTTCTCTTTAGAGCCAGTTGACTCTAGAATGAGACCTCTTCGTTTG
AATCATCAATTAAGACTCCTTACTCCCCAAGTTAAAGACGGAGATCCTGCAAAGCTATAA
CTAGTTAGGGAAGAAAGAGAGTAAAGAGAAAAATTGAAAGATGATTTAGTAAAAGGAAGA
TACAAGAAGGAGTTAGAAAAGCAAATGTTAAAATATAAAGGCCATAGATTTATTTCAGAT
GAAGACTATTCAAAATTAATTGATATTAGTGTTAAAACAATAGTACTTTCTGAAATTCAA
ATAGATAAATACATTGACATTAAAATGGAAAAAAATAAATTAAACGTTTTTTATGAAGAT
GATAGAAAAATTTTATTGTAAAAATAAAAAGTTTTAGGAGAAACCATTACAAATGAAAGA
ATTAAAATTAAAAAATAAATTGTTAAGGATATTGAAAATATTCCTCTACTTTAACACTCT
GCATTCGCTCGTAAATATATTAATAATAAGGGACCAAGCATAAGCAAATTCAGCAAATAA
TTCTTTGAAACAAAGCTAAAAATTCTAGAACTTCTCTTTCATATTGATTTTAAATTGCTT
TAATTTGAGTGTGGCTCTTCTTAACTTCAAACAAAAGAAGAAATTCAAGGTAAATTTTGA
ATAAAAAATAACATTTTAAATTACTATGACAGATTGCTTTTAATGTAATCAATAAATAGA
AATTAAATTTTACAGCAGTTTTTTCATAACTATTTTTAAAATATAAAAAACCATCTAATT
TCTGAATATTTAAATTCAAGTTACTTTCTTTTATTTTTAAAATTAAAATTTTCTCTCTAA
ACTTACAAATGAAGTTATGCTTCAAAACAAAGCTATTTTGGTTTATAAACATTTTATAGT
TAGATCTAAATCGTATATATATTATTTATTTTAGTGGAAAGATGTAGATTGATAGATACT
ATTTTTCTTAGATAAAATAATTTTATTTTATTTTTTAATGCTATAAAAATGTTAAAAATT
AATAAAACATCTAAAATAGCAATTTATTTATCATGATTTTAATTTGATAGAAGTTTGAAT
TAAAAAATAATTTTATAATAGAAAATAATGAAGAATCATACAATACTTACTTAGGATATC
TAAGCTATCTTGAGAAACTTAATGAACTCATTTAAAAAGTAAGAGAAAAGTATAGAGACA
AAGAGGAGTATGAAATCGATTCATACACACTTAAATAGATTTTAGATACAAAGAGACCTA
TTGAATTAAAGTCGTTGTTAGGTAGAAATAAGAAAAAACAAAAAACATATGTTGTGAAGA
AGATTAAGACTACTCCAAATGAATAAGCACTAGAAATACATGTAAAAAATAAAATAAAAT
TATTATTTTTAAGATTATTAATGAAATAAATTAGATTCCTGCAGCTAATTGGAAAAAGTA
CATTTATGGAAATATGCAGCAAGAGATTTATGAAGCATTTACTTTAGCTCTTAGAAGAGC
TCAGAAAGGCCCAAATGGTAGGAATATTAAGACTATTTGGGATTATTAAGGATAATCAGT
TTAGCAAATATTTTCTGATTATATTTACGTACCAAGCTCTAAAAGAATTCGCAATAAAAT
TCTTCTAGAAAATTGCTGGCAAAGATAGCCAATAAACTTAAATGAAAAAATGGAAATATT
CAACAAGATGGAAAGAATAAAGATTACTACTTCTTTATTAGTTAGTATTAAATTAATTTT
AATATATATTTTATTTCTATCAGTCTTCCTTGAATTCTAAACTTTTATTATAATAAAAAA
GGCTTGCTTGATTTTTCAAAGCTCAAAACTCAAGAAGACCTCATTTACGATTACTTCCCA
TTGCATGATAAATACTTGCTTTTTGGGTAACGTGAACACTCTGATATTTTTAGGAGGATT
ATATAAGAAAAGATAAAATAAGATTACCCAAACGAAGAGGATTATAAATTTTAGATAATT
AATTCTGATAAACATTATGAGTTATAAATAAAAAATTACTAAATGATTACAGATTTATGC
TTATTACCAAATTGGAATCCTTTGTTGATATATAATGTTCCTGAATAAGAAATTTGTGAA
TATTTTGGAGAAAGAATTGCTCTTTATTTTACTTTCCAAAGCTTTTATTTCAAAGCTCAG
TTTTCTGTTGCTTTATTAAGTACTCCAATTTTCATCGTTTATGAGTATTTTGGTCAAACA
GATAAAGGATTAGGTGCTCAAATAGCTGGTTTGATCCATATATTTATTGTTGTTATATGG
TCAAATGTATTTTATGGACAATGGACTTATAGAGAAGCAGAATTTTCTTTAAAGTACAAC
CAATCTCAAAGTGGTGAAGATGAAGAAGATATAAGGTTTTAACTTATTTCTAATAAATCT
AAAATATTTTTGATCACTAAATAATTATTTATTTAATTAATTAATTAACAGACCTGGTTT
TAGAGGCGAATACGAACGTTCAATTACATCAAACAAGTTGAATGATTACAGTTATGACAG
AAGATTAACTGAAAAATCTGAAAGAAACTATTGGATTTTAATATTTTTTATACTAATAGT
AAACATAGTTATTATTTACGCTCTTATATACTTGTAATCTTACTTTGACGATCACAACAC
AATAGACTCTGGAAAAACTTTTATGGGATTGAACATATTTATTCCTACAATAATTCTTGA
GTTCATCTTCTGGGTTGAAGAATTCCTCTTTAAGAAATTTGCCTTATTCACCTGCAGAGA
AGCTAATTTCAAAACAACAAAGGAATTTGAATAAAGCTATTCAACCAAATTGTTTACTTT
TATATTCTTTAACCACTTAGTCCCTCCTACTTTGATTTCGTTTATCATAGATCAAAACAT
AGGTTGTGTGTAGGATGATTGCTCTTATCATCTCTCTGTTTATATTAGATCATATTAGTA
CATCATAGTATTTAAAAGTATAGTTGAAATAATTTATCCTTTACTTAGAAGCTCTCTTAA
TAATGTCACTCAGTTAGTTAAATAGCTAGTTAACAAAGATGTAGATCAAAAGTAGTAATA
TCTCTTCGATCATGTTAATATAGAAATCGAGAACCAATCAGGATTAAGTAAAATAAATAA
ATAACTTAAAAATTGCTTTTAAAATAATTATATTTTTAAATAGTGGACAGTGTGATAGAT
GAAATAGATCAGCCAACAAGAGATTATATTGAAATGTTTACCTATTATTGCTTTAATGTT
ACTTATGGATTTGGTTTTCCTCTTGTTTTTGCTATAACTTTTGGAATCACATTTATTAAA
ATGATTGTCACTAGAAGACTTTTTACAAGAAGAATCAAGAGACCTAATCCATAAAATGCT
TCTACAATAGGTATTTTCAGGCAATTTATGAATTTAGGTTCTTCGTTATCTATTCTTACA
TACACTGGTATATTCTGCTTCACAAGAAGCCAAAAGCCTGACTGGGGTCCTTTCACTCAA
CTTAATGCATTTATGTTTATTTCATTTTTCTTCTTTGTCGTGAAATTCTTTATTGATAGA
TATTACTCTGAACTCGATTCCAAGACTATGGATATTTTAAAAAGACAGGCATTTATCAGA
GACAATTACAACCTTAAAAATAATCTATCTGGACCATCTACAAAGGTAGTAGAGTCTAAT
CCTTTCTTTAAAGTATATGGTACATATCTAGAAGATAAAACAGAGCAATTAAAGAAAAAT
AATTGA