Identifiers and Description

Gene Model Identifier

TTHERM_01114180

Standard Name

NRK35 (NIMA-Related Kinase )

Aliases

PreTt01924 | 240.m00047

Description

NIMA-Related Kinase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_01114180

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19400.19.997093137033517e-262protein kinase domain-containi
ng protein (976 aa)
DictyBaseDDB_G02892779.996162112727537e-67nek4 on chromosome: 5 position
2561379 to 2563106
OxytrichaContig6078.0.1.g704.0015855602347305e-61Protein kinase domain
WormBaseWBGene000214612.000704504372864e-47locus:nekl-1 status:Partiall
y_confirmed UniProt:Q6AW07
protein_id:CCD69902.1
SGDYHR102W1.000137892321693e-31KIC1 Protein kinase of the PAK
/Ste20 family, required for ce
ll integrity; physically inter
acts with Cdc31p (centrin), wh
ich is a component of the spin
dle pole body; part of the RAM
network that regulates cellul
ar polarity and morphogenesis
Stentor CoeruleusSteCoe_30631.603810890548638e-28

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16611747: Wloga D, Camba A, Rogowski K, Manning G, Jerka-Dziadosz M, Gaertig J (2006) Members of the NIMA-related kinase family promote disassembly of cilia by multiple mechanisms. Molecular biology of the cell 17(6):2799-810

Sequences

>TTHERM_01114180(coding)
ATGGAGAAATATGACAAAGTTAAGTTAGTGTGTAAAATTGAAATGGGAGATGTATTTCTA
GTAGAAGAGAAAACTTCAAAGCATAAATATATCATGAAGAGGATTTTTATTGATGAAAGG
GAATAGTAAACCTATCACCCAGAAAATGAAGCTAAATTACTTGAATAGCTTGACCATCCA
AATATTATAAAAATGCAGGAACATTTTTATCATAAAAAATATTTTTGCTTAATTATGGAG
TTTGCAGAAAAAGGCGATTTAAATAAATTGATCTTAAACCTCAAACAAAAAGAAGAATAT
TTAAATGAAAAGCAGGTATTAGACCTATTCTGTTAGCTCTGCCTAGCTGTTAAGTATCTT
CATGACAGAAAATACATTCATAGGGATATAAAAATACATAACATATTCCTCTCTAATGAG
AATATTGTGAAATTAGGAGATTTTGGGATATCAATTTAGCTAGATAAAAGCGAGATATAT
GCTAAGACATAGCTAGGAACTCCATATTATTTATCTCCTGAAGTAGTCTAAGGAAAGAAC
TATGATTAAAAAGTTGACATTTGGATGATTGGTTGTTTTTTATATGAAATTTGTGAATTA
TCAAGACCATTTTAAGGTGCTACTTGGTCTGAAGTTGATTACAAAATATAAAATATTGAA
CCAGAGCCTATAGATGAATCATATAGCTAATTTTTATAAAATCTAGTTAAAAAGCTTCTT
TAAAAAGATCCTCAATAACGGCCAAGTATAAATGACATTATAGAAATGCCAGAAATTATA
CAAAATCTTAAATAAATGTCTAAGGACGAAGTTTATTCTTAATATTTGATATTCCCTGAA
TTTATTTATCAGGATGAAGAAGAAGAAGAAAATGAACATGAAAAAACAGTGATTAAAGAC
AATGAAAACTATTGTAAGGCAGAAAAAAATATAGAAAGTATTTTAAAAAACGTAGAAGAG
GAGCAACTTGCAAAATATTCTTTATCTTATTTGTTGAAGAAAGCTGCTTAAAGTGTATAA
AAAGAAGAGATGCTCTTAAAAAAATAAAAATAAGATAAATTAGAACAAAAAAAATAATTT
TCTATAAATGGAGATTAAAGCGAATAACTGGAAAATAGTAAAATCAATTAAGAAATTCTT
TATACATAAAATTTAAATAATACAAAAGACTCTCAATAAGTGAAGAAAAATAAATTTTAG
TAAAAATTTTATGAGAAAAAAAAGCAGGAATTAAATATTTGCACGATTAATGGCTAAGAA
GATGAATAATCCAATATTATTACTCAATCTTAATAGTCTAAAAATATCTAAAAAAATGCT
TCAGCCCCAACCACAACAAAACCAAATCAAAAGCATTTAGCAAATGTTTCATAAATACCA
AAAGAGTCATATGTAAATTATGAACCAGTTGGAATAGATTTACCATGTAATGATGATTCA
AGCACTAAAATAACTTCATATAATTAAAAAGAAACTTAAAATCTAACACCAGAATAGAAT
ATTAAATAAATTTCACAAATTTCTTAAACAACACAAAACACAATAGATTCTACTCCTAAT
AGATTAAAAGTTAATGAATTAAAAGATTAAAACTAAGATAAAAGTACCTAATTTTTGTAA
GAAAAAGTTATGTAAAACAACTCTAATTTGTCATAATTAACTTCAGCTTCGAATAATTAA
AAGCCTACTGCAAACTAAGAGATATAAAGCCTTAATTAATAAATTATAAATACCAATCTA
GTAGAACATAATAATTCTAATGATTAAAAAGTGCCCTGTAATGGATAACCAACCACTAAA
TAAAATTAGCAAAGCTTTAGCTTTTCAGCTAATTAGTATGCAAATCTACTTAAAACTCCT
CAACTTCCTAACACAATACTTTTTACTTAGTTTTTAAAGGAAAAATTAGGAAAAGAGAAG
TTTACTAAAATGAAATATTTGCTTGAAGGTAGTTAAAATCCTCTTAAACTTCTTGATGAA
AATACTGAGCTAATTACTGAAATAATTGGACCAGAAAATATTGATTGCATTAATTATTTT
AGATGCTTAATCACCAGTAGCGTTACACCACCTGGTAGTCACTTCAGAGCCCGCTCAACT
GCCAATTCTCCTTGCTAAACCTTAAATAAAAATTTATTACCATAACCTTAGCATTCAAAT
TAGGGAGTTTAAGCATTTTAAATTCATCTCAAAAGCGCTAATTAAAATGAACAACAATAA
CAAATGATTTAACTTTAGAAATAAGGATCTTTGCAATAACAATAGCATCAAATTCCTACA
ATTAGCAATAATTCATCATATGTTTAAGGTTTCCATCAATATAATAACAACAATATACAA
AATAATAACCACCATATTTATAGAAACTAAAGTGTTTACTCTTAACATTCCTAATAAGGC
TAAATGTCTGTTGGAAGTTCTCCTTAATATTTTAACAATAGTAGCAATAGAATATTTGAA
AATAATTTTAATTTATTTTAAAGTTGTAATAACGATAAAAATTCTTTTTAATCAGAATGG
TCATACATTTTGAGCTAACCAGGAAATCTAAATTGTCAAAACACTCATTTAATAAATTAA
GGAAATGTTACCAGTAGCCTATCTAATAGAAATGCATAGTTTAGTAATAGCCAGCCTTAG
CAACAAAGCAGCTTTTAAATATATAATTAATAACAGTAGTAATTTATTTAAAATAAAATA
CCTTTAAACTCATATCAACTAAAGCAATTTCCAGCAAATCATAAAATCGCAAGCACGACT
CAAAATTAAAATTAAAAACAAATGTTTCACTCATCTCATTTTTATCAGTAATGA


>TTHERM_01114180(protein)
MEKYDKVKLVCKIEMGDVFLVEEKTSKHKYIMKRIFIDEREQQTYHPENEAKLLEQLDHP
NIIKMQEHFYHKKYFCLIMEFAEKGDLNKLILNLKQKEEYLNEKQVLDLFCQLCLAVKYL
HDRKYIHRDIKIHNIFLSNENIVKLGDFGISIQLDKSEIYAKTQLGTPYYLSPEVVQGKN
YDQKVDIWMIGCFLYEICELSRPFQGATWSEVDYKIQNIEPEPIDESYSQFLQNLVKKLL
QKDPQQRPSINDIIEMPEIIQNLKQMSKDEVYSQYLIFPEFIYQDEEEEENEHEKTVIKD
NENYCKAEKNIESILKNVEEEQLAKYSLSYLLKKAAQSVQKEEMLLKKQKQDKLEQKKQF
SINGDQSEQLENSKINQEILYTQNLNNTKDSQQVKKNKFQQKFYEKKKQELNICTINGQE
DEQSNIITQSQQSKNIQKNASAPTTTKPNQKHLANVSQIPKESYVNYEPVGIDLPCNDDS
STKITSYNQKETQNLTPEQNIKQISQISQTTQNTIDSTPNRLKVNELKDQNQDKSTQFLQ
EKVMQNNSNLSQLTSASNNQKPTANQEIQSLNQQIINTNLVEHNNSNDQKVPCNGQPTTK
QNQQSFSFSANQYANLLKTPQLPNTILFTQFLKEKLGKEKFTKMKYLLEGSQNPLKLLDE
NTELITEIIGPENIDCINYFRCLITSSVTPPGSHFRARSTANSPCQTLNKNLLPQPQHSN
QGVQAFQIHLKSANQNEQQQQMIQLQKQGSLQQQQHQIPTISNNSSYVQGFHQYNNNNIQ
NNNHHIYRNQSVYSQHSQQGQMSVGSSPQYFNNSSNRIFENNFNLFQSCNNDKNSFQSEW
SYILSQPGNLNCQNTHLINQGNVTSSLSNRNAQFSNSQPQQQSSFQIYNQQQQQFIQNKI
PLNSYQLKQFPANHKIASTTQNQNQKQMFHSSHFYQQ


>TTHERM_01114180(gene)
ATGGAGAAATATGACAAAGTTAAGTTAGTGTGTAAAATTGAAATGGGAGATGTATTTCTA
GTAGAAGAGAAAACTTCAAAGCATGTAAAATTTTAAGATTTGTTATTATATTCCATTTAA
TTTTCTACTTGTTAATATGCAATAATTATTATCTTGAATACTTCATTTTAAATAAAATTT
GGTTAATCTAAAAGAAATATATCATGAAGAGGATTTTTATTGATGAAAGGGAATAGTAAA
CCTATCACCCAGAAAATGAAGCTAAATTACTTGAATAGCTTGACCATCCAAATATTATAA
AAATGCAGGAACATTTTTATCATAAAAAATATTTTTGCTTAATTATGGAGTTTGCAGAAA
AAGGTAAACTAATGAATTTAAATTTAAAAATTATTTACTAACTTATGTATTTCAAAACCT
ATTCACTCTTTAAGTAATTTTTTTTCAAACAGGCGATTTAAATAAATTGATCTTAAACCT
CAAACAAAAAGAAGAATATTTAAATGAAAAGCAGGTATTTTTACTTTATCTGTTATTACT
AATTTCTCTAAATTACTCTAAAAACATAAAGAATTTGCAAATTAATATTTTTTTAAATAC
TTACTTTATTTTTTAAGGTATTAGACCTATTCTGTTAGCTCTGCCTAGCTGTTAAGTATC
TTCATGACAGAAAATACATTCATAGGGATATAAAAATACATAACATATTCCTCTCTAATG
AGAATATTGTAAAATTTTATTTGCTATAAATATGATAAAACGCTAATCTATGAAAACCTA
CATACAACTGAATAAAATTTAAAATTGTTATATTAATAGGTGAAATTAGGAGATTTTGGG
ATATCAATTTAGCTAGATAAAAGCGAGATATATGCTAAGACATAGCTAGGAACTCCATAT
TATTTATCTCCTGAAGTAGTCTAAGGAAAGAACTATGATTAAAAAGTTGACATTTGGATG
ATTGGTTGTTTTTTATATGAAATTTGTGAATTATCAAGACCATTTTAAGGTGCTACTTGG
TCTGTAATTTATTCAAAATTGTTATTATTAAAATTTTTGTATGAAAAAAAATATATTTTT
AACCAAAATTTAACTTTTAAAATAATCAAAAAAGGAAGTTGATTACAAAATATAAAATAT
TGAACCAGAGCCTATAGATGAATCATATAGCTAATTTTTATAAAATCTAGTTAAAAAGCT
TCTTTAAAAAGATCCTCAATAGTAATTTATTAAATTATTAATGGATAATTATTCTAATTC
ATATTTTTCTTTTTTGGTCAAAAAAATCTTAAAAGTCAATTTAAAAGTTAATTTAATTAT
TTTCATTATATAGACGGCCAAGTATAAATGACATTATAGAAATGCCAGAAATTATACAAA
ATCTTAAATAAATGTCTAAGGACGAAGTTTATTCTTAATATTTGATATTCCCTGAATTTA
TTTATCAGGATGAAGAAGAAGAAGAAAATGAACATGAAAAAACAGTGATTAAAGACAATG
AAAACTATTGTAAGGCAGAAAAAAATATAGAAAGTATTTTAAAAAACGTAGAAGAGGAGC
AACTTGCAAAATATTCTTTATCTTATTTGTTGAAGAAAGCTGCTTAAAGTGTATAAAAAG
AAGAGATGCTCTTAAAAAAATAAAAATAAGATAAATTAGAACAAAAAAAATAATTTTCTA
TAAATGGAGATTAAAGCGAATAACTGGAAAATAGTAAAATCAATTAAGAAATTCTTTATA
CATAAAATTTAAATAATACAAAAGACTCTCAATAAGTGAAGAAAAATAAATTTTAGTAAA
AATTTTATGAGAAAAAAAAGCAGGAATTAAATATTTGCACGATTAATGGCTAAGAAGATG
AATAATCCAATATTATTACTCAATCTTAATAGTCTAAAAATATCTAAAAAAATGCTTCAG
CCCCAACCACAACAAAACCAAATCAAAAGCATTTAGCAAATGTTTCATAAATACCAAAAG
AGTCATATGTAAATTATGAACCAGTTGGAATAGATTTACCATGTAATGATGATTCAAGCA
CTAAAATAACTTCATATAATTAAAAAGAAACTTAAAATCTAACACCAGAATAGAATATTA
AATAAATTTCACAAATTTCTTAAACAACACAAAACACAATAGATTCTACTCCTAATAGAT
TAAAAGTTAATGAATTAAAAGATTAAAACTAAGATAAAAGTACCTAATTTTTGTAAGAAA
AAGTTATGTAAAACAACTCTAATTTGTCATAATTAACTTCAGCTTCGAATAATTAAAAGC
CTACTGCAAACTAAGAGATATAAAGCCTTAATTAATAAATTATAAATACCAATCTAGTAG
AACATAATAATTCTAATGATTAAAAAGTGCCCTGTAATGGATAACCAACCACTAAATAAA
ATTAGCAAAGCTTTAGCTTTTCAGCTAATTAGTATGCAAATCTACTTAAAACTCCTCAAC
TTCCTAACACAATACTTTTTACTTAGTTTTTAAAGGAAAAATTAGGAAAAGAGAAGTTTA
CTAAAATGAAATATTTGCTTGAAGGTAGTTAAAATCCTCTTAAACTTCTTGATGAAAATA
CTGAGCTAATTACTGAAATAATTGGACCAGAAAATATTGATTGCATTAATTATTTTAGAT
GCTTAATCACCAGTAGCGTTACACCACCTGGTAGTCACTTCAGAGCCCGCTCAACTGCCA
ATTCTCCTTGCTAAACCTTAAATAAAAATTTATTACCATAACCTTAGCATTCAAATTAGG
GAGTTTAAGCATTTTAAATTCATCTCAAAAGCGCTAATTAAAATGAACAACAATAACAAA
TGATTTAACTTTAGAAATAAGGATCTTTGCAATAACAATAGCATCAAATTCCTACAATTA
GCAATAATTCATCATATGTTTAAGGTTTCCATCAATATAATAACAACAATATACAAAATA
ATAACCACCATATTTATAGAAACTAAAGTGTTTACTCTTAACATTCCTAATAAGGCTAAA
TGTCTGTTGGAAGTTCTCCTTAATATTTTAACAATAGTAGCAATAGAATATTTGAAAATA
ATTTTAATTTATTTTAAAGTTGTAATAACGATAAAAATTCTTTTTAATCAGAATGGTCAT
ACATTTTGAGCTAACCAGGAAATCTAAATTGTCAAAACACTCATTTAATAAATTAAGGAA
ATGTTACCAGTAGCCTATCTAATAGAAATGCATAGTTTAGTAATAGCCAGCCTTAGCAAC
AAAGCAGCTTTTAAATATATAATTAATAACAGTAGTAATTTATTTAAAATAAAATACCTT
TAAACTCATATCAACTAAAGCAATTTCCAGCAAATCATAAAATCGCAAGCACGACTCAAA
ATTAAAATTAAAAACAAATGTTTCACTCATCTCATTTTTATCAGTAATGA