Identifiers and Description

Gene Model Identifier

TTHERM_00412080

Standard Name

NRK33 (NIMA-Related Kinase )

Aliases

PreTt21626 | 44.m00293 | 3714.m00139

Description

NRK33 Serine/Threonine kinase domain protein; Protein kinase domain containing protein. Sequence similarity to the NEK protein kinase family (Eisen et al.- 2006).

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00412080

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10393.19.997093137033517e-262protein kinase domain-containi
ng protein (1143 aa)
OxytrichaContig544.1.g86.000414531663983e-92Protein kinase domain
DictyBaseDDB_G02752412.0008958828286524e-54nek3 on chromosome: 2 position
4983790 to 4987279
WormBaseWBGene000089561.0002546821282671e-50locus:nekl-3 status:Confirme
d UniProt:G5EFM9 protein_i
d:CAA92169.2
Stentor CoeruleusSteCoe_107171.0112214926104486e-43
SGDYAR018C3.998777993244535e-41KIN3 Nonessential serine/threo
nine protein kinase; possible
role in DNA damage response

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16611747: Wloga D, Camba A, Rogowski K, Manning G, Jerka-Dziadosz M, Gaertig J (2006) Members of the NIMA-related kinase family promote disassembly of cilia by multiple mechanisms. Molecular biology of the cell 17(6):2799-810

Sequences

>TTHERM_00412080(coding)
ATGAATACAAACAATCGATAGTAAAGATCTGAATCTGATAAAGAAAAAGCACGTTTGATG
AATGGTGTAGATATCAATTCAGAAAAATAGGAGCACGAAGACAATAAGCGATAAATAGGA
TCATGTGTTTCTGATTTTACTATAGTGAAGGAATTAGGTAGAGGTTCGTATGGTGTAGTG
TATAGAGCAATATCTAATATCAACAAAAAAGAGTATGTAGTGAAGAAAATAAATATCAAA
CACATGAGTAATAAGCATTAAAAAGAAGCTCTTAAGGAGGCGCAAATTCTACGTAAAGTC
AGACATGAAAATATTATCAGATACTACACTTCTTTTGTAGAGCATGATTGTCTTTATATA
GTGATGGAATACGCAGATGGAGGTGATCTTTAATAACTTCTTAGATATCGTAGAGAGAGA
AAAAAATAGTTTACCGAAACAGAAATATGGGAATTTGCTTATGATTTGATTAAAGCAGTT
GATTATTTGCATAAAAATAATATAATACATAGAGATATCAAGACATTAAATATATTTCTC
ACTAAAGATAGAAAAGTCAAGTTAGGTGACTTAGGTGTCTCTAAAATAGTATCAAGCCAA
GCTGCATTGTAAGGAACTAGAGTAGGTACTCCTCTGTATCTTGCTCCTGAGCTTGTTAAA
TAGTAACCATACGATTTTAAAGTAGATATTTGGGCAATTGGAATAGTGCTATATCACATT
AGCGCTCTTGAGCCACCATTTTAAGGAGAGAATTTAATTGCTTTAGGGTTTAATATAGTC
CATAAATTTCCGAAGCCATTGCCAAGTGTTTATTCTCCAAAACTTGTTAGCTTTATTAAT
AAGCTGCTAGAAAAGAATCCACTTTAGCGTCCAAAGACATCGGAATTAATTGAAACATTT
CCTAAAAAGAGTGAAAGACCCATGACGGGATAACCATAAAATTCTAATTCTTGGTAAAAT
AATGCTCTAAAAAACTCTTCAAGCTAGGTTATCAATGATAAGATTGAAGTATATGATAAG
GGGAATTATAATATGCTAAATAGAATTATAGAAGAAGATTAAGAAATGGCTGCAGCATTT
CAACACAAGATAGATAATAATAAAAGATCTTTAGAATTAAATGACTTTGATAATAAAATA
CAGGGTCAACCATCAGTATTACCTTATCATATGAGAAGACCTTAAACAAGTGTTGGTAGA
GATAAGGAAAAGCTGTTATATTAGCAAAGAATGTAAGAAAATATTAACAACGAATATAAT
AATCTAAATGTTAAATCATACAAAAATAATGCAAATTAAATAGATAATTAACAAGACTTA
AAAAACCAATTTAATGAGGATTTAACTGATCCTAGAAACAACAAATAAGCGAAGCAAATT
GATAGGAGTGATTCTTCTTCTTCTTCCTCATCAAATTATCATAATATCAATAATAATGCT
AATCGAGAGGTATTAGTTATGGGTAATAATAATGCTGCTTCAACTTCAAACAATAATAAT
ATAGGGAGATATTTAAGTAAAAACAAAGAGATAATGACTTATAATAAAAAAAAGATGTCG
TTGATTACTGACAGCAGTATACTTAATGATGATAAAAAGAAGAGTGGTAGTACACGTTAG
TCAACTACTTAACAAGGAATTAATTACTAATCTAACAGCAACAGTCAAGCAACCAACGAT
GAAAAGAAATAAAATTAAAATGAAGATAAAAAACTGAAATTAGATTTATAAACATAACAG
TAACAGTCTTATTTGCCTACCCACAAAGTAAACTCTTAAAGCCAATAAATTTAAAAATCA
AATCAAATTTTAAGCTCATAACACTCTCCATTGGAGAATCCTTTAAATTCACATAGAGTT
TTAACTTAAGCTACAGAAAAATAAGCAGAAAAAAACTATAGTAGTAATAACAATAATGTT
TCAGGCGGAGAGTTTAATCAAAAAGCTAATTAATACCATGTTTAAGGTAAATCTTAAAAT
AAAAATAAAAATGATGAGTAGGAATTGGAACAAAAAAAGAGGATTTAGAGCTCTCTAGAT
GAAGGTTTAATGGTATAAGAAAAAATAAAATAGAGCAAAGAAAACACTCCTGGAAATAGT
TAAAATAATAAAGATATAAAAGCTTCTCTTGAATAAAAGTAAAAAGATACAATAAACCAT
CCTCAATAGTAGTAGTAGTAGTAGTAGTAGTAGTAGCAGAAATTGATCTCTTAGCCTAGT
AATTTAAAGGACACAAAAGAAACAAAAGAAATTAAAGAATATCTTAAAGATATTAACAGT
AATAATAATATAAACAATAATGCTTCTAATAAAAATAATGAGATTAAAGGTCAAAATCCT
TTAGTTGCTTATTTCAATATCAGCAAATCAATGAGTGATAATTTACAAAGTAATTTTAAA
ATTCGTCCTTTTTCAGCATAAACGAAACCTAGATAAAATGAATTAGCTAAAAAACCAGAA
GTTAATAATTTTATTAAGAATGAAATGATTTCAAGCTAAACTAAAGATGCTATGAAATTG
GAGTAAATAATCAAAGAATTTAAATAGGAAGCTCAAAAAATTAGAGAGGCACCACTAATT
ATTTACTCAAATGGTTAAAATCAGCCATAAACTACTCCTAAGGATCATAAAAATTCAATC
GAAACTAAAAAGAACGATAAAAATACTAATAATGGGCCACATTAGAGTTCTTCAACTCAG
TCTAACAAAAAAGAGCCTTCCAACCAGTAGTCACAATAAAATAAAAATGTGAACTAAAAT
GATATTAAAACAGAAAACAAAAGGAAAGAAGACAATAATTTAGGAAATGAAAATGTAATC
AGACCATAGTCAGCTCATCCTTTAGTAGGAAATAGATAGAATAAAGTCTTTAATTAGTTT
AATAACAGATATGTATCACCAAATTAATATATAGCAGGATTCAGTAGTCCGTTCTAGAGC
AACCCAAATACAAATACATCTCATAAATCTATTGTAAATAATTTTATTAAAAACAGCATA
GGCAAAATGAACAATAATGTTATTATAGATCCTGTAACTAAACCATAAAAAGATTAAAAC
TAAAATTAAGAAAATGATAAAAATTACTTCTTTTATAGAATTGACAACGTATAAAGAGAT
TTTAATGAAGAAATAAATCCTTAATCTACCAAATCTAGTTCATAAAAAATGGATTTAACT
TCAAAGATTAAATCAGCAACTTCTACCAATTTTTATAAGGAATAATCTTAAATGACCGTA
AGTGTTAAGGGAGGAAATTCTTAAAATCTTGATAATCCACAATAACAGTAAAATAAAGAA
AAGTAAAGTTAAGGAAAAGTTTTAGTATTAAACAATGCTCGCCCATAAACTTCAACAGGT
GTAAGAAAAAAGTATACAATTAAAGATTTAGTATCTGATTAACATGTATTTCGCACTAAC
TAAGTAGTGAGTCAATGA


>TTHERM_00412080(protein)
MNTNNRQQRSESDKEKARLMNGVDINSEKQEHEDNKRQIGSCVSDFTIVKELGRGSYGVV
YRAISNINKKEYVVKKINIKHMSNKHQKEALKEAQILRKVRHENIIRYYTSFVEHDCLYI
VMEYADGGDLQQLLRYRRERKKQFTETEIWEFAYDLIKAVDYLHKNNIIHRDIKTLNIFL
TKDRKVKLGDLGVSKIVSSQAALQGTRVGTPLYLAPELVKQQPYDFKVDIWAIGIVLYHI
SALEPPFQGENLIALGFNIVHKFPKPLPSVYSPKLVSFINKLLEKNPLQRPKTSELIETF
PKKSERPMTGQPQNSNSWQNNALKNSSSQVINDKIEVYDKGNYNMLNRIIEEDQEMAAAF
QHKIDNNKRSLELNDFDNKIQGQPSVLPYHMRRPQTSVGRDKEKLLYQQRMQENINNEYN
NLNVKSYKNNANQIDNQQDLKNQFNEDLTDPRNNKQAKQIDRSDSSSSSSSNYHNINNNA
NREVLVMGNNNAASTSNNNNIGRYLSKNKEIMTYNKKKMSLITDSSILNDDKKKSGSTRQ
STTQQGINYQSNSNSQATNDEKKQNQNEDKKLKLDLQTQQQQSYLPTHKVNSQSQQIQKS
NQILSSQHSPLENPLNSHRVLTQATEKQAEKNYSSNNNNVSGGEFNQKANQYHVQGKSQN
KNKNDEQELEQKKRIQSSLDEGLMVQEKIKQSKENTPGNSQNNKDIKASLEQKQKDTINH
PQQQQQQQQQQQQKLISQPSNLKDTKETKEIKEYLKDINSNNNINNNASNKNNEIKGQNP
LVAYFNISKSMSDNLQSNFKIRPFSAQTKPRQNELAKKPEVNNFIKNEMISSQTKDAMKL
EQIIKEFKQEAQKIREAPLIIYSNGQNQPQTTPKDHKNSIETKKNDKNTNNGPHQSSSTQ
SNKKEPSNQQSQQNKNVNQNDIKTENKRKEDNNLGNENVIRPQSAHPLVGNRQNKVFNQF
NNRYVSPNQYIAGFSSPFQSNPNTNTSHKSIVNNFIKNSIGKMNNNVIIDPVTKPQKDQN
QNQENDKNYFFYRIDNVQRDFNEEINPQSTKSSSQKMDLTSKIKSATSTNFYKEQSQMTV
SVKGGNSQNLDNPQQQQNKEKQSQGKVLVLNNARPQTSTGVRKKYTIKDLVSDQHVFRTN
QVVSQ


>TTHERM_00412080(gene)
ATGAATACAAACAATCGATAGTAAAGATCTGAATCTGATAAAGAAAAAGCACGTTTGATG
AATGGTGTAGATATCAATTCAGAAAAATAGGAGCACGAAGACAATAAGCGATAAATAGGA
TCATGTGTTTCTGATTTTACTATAGTGAAGGAATTAGGTAGAGGTTCGTATGGTGTAGTG
TATAGAGCAATATCTAATATCAACAAAAAAGAGTATGTAGTGAAGAAAATAAATATCAAA
CACATGAGTAATAAGCATTAAAAAGAAGCTCTTAAGGAGGCGCAAATTCTACGTAAAGTC
AGACATGAAAATATTATCAGATACTACACTTCTTTTGTAGAGCATGATTGTCTTTATATA
GTGATGGAATACGCAGATGGAGGTGATCTTTAATAAGTTAATACATAAATATTATTTCTA
TTATTCTATGGTTCAAATACATTTTTAAATATCAATTCAGTAATTCTTAAATCATGCAAG
CCATTATATTTATTATCCATTGTTATTAGGATGATACTTTGATCTGAAAATCACCAAAAA
AATAATATTTCTAAAAAAAAGTTACAGCATCATCAATTAAATTTATTGTATTTTGGATTA
CCTATCGCTTGCTAATTAATTTAAATGAATAATTAAAAAATTTTTCACTGAAACTGATTA
ATAAATGTAAATAATTTTAAAAAAATAGCTTCTTAGATATCGTAGAGAGAGAAAAAAATA
GTTTACCGAAACAGAAATATGGGAATTTGCTTATGATTTGATTAAAGCAGTTGATTATTT
GCATAAAAATAATATAATACATAGAGATATCAAGACATTAAATATATTTCTCACTAAAGA
TAGAAAAGTCAAGGTAAAAATTCTATCAATTTGACTGATTTAAATTAAACTAATTGATCG
TTTTCAATTATAATACATTGCTAATTTTTATATTTTAATAGGATTTATTTATTTATTTTT
CATTTTTGTCAAAAGAAATGAAAAGGAATTTTTTGTAGATTATTTTATCTATATTTAGAT
TTATAATTTAATTTCACTTTATTCAAAACTCAAACAATTAAATAAGCTATTAAAACTTCT
TCTTTTAATAGTTAGGTGACTTAGGTGTCTCTAAAATAGTATCAAGCCAAGCTGCATTGT
AAGGAACTAGAGTAGGTACTCCTCTGTATCTTGCTCCTGAGCTTGTTAAATAGTAACCAT
ACGATTTTAAAGTAAATTAATTAATAATTTATAATTAGTTAAAATCAATAATTTTAAAAT
AATTAGGTAGATATTTGGGCAATTGGAATAGTGCTATATCACATTAGCGGTAATTTATTT
ATTTTTTTAATAAGTACTTATTTTAAAATGTTAATAAAATAGCTCTTGAGCCACCATTTT
AAGGAGAGAATTTAATTGCTTTAGGGTTTAATATAGTCCATAAATTTCCGAAGCCATTGC
CAAGTGTTTATTCTCCAAAACTTGTTAGCTTTATTAATAAGCTGCTAGAAAAGAATCCAC
TTTAGCGTCCAAAGACATCGGAATTAATTGAAACATTTCCTAAAAAGAGTGAAAGACCCA
TGACGGGATAACCATAAAATTCTAATTCTTGGTAAAATAATGCTCTAAAAAACTCTTCAA
GCTAGGTTATCAATGATAAGATTGAAGTATATGATAAGGGGAATTATAATATGCTAAATA
GAATTATAGAAGAAGATTAAGAAATGGCTGCAGCATTTCAACACAAGATAGATAATAATA
AAAGATCTTTAGAATTAAATGACTTTGATAATAAAATACAGGGTCAACCATCAGTATTAC
CTTATCATATGAGAAGACCTTAAACAAGTGTTGGTAGAGATAAGGAAAAGCTGTTATATT
AGCAAAGAATGTAAGAAAATATTAACAACGAATATAATAATCTAAATGTTAAATCATACA
AAAATAATGCAAATTAAATAGATAATTAACAAGACTTAAAAAACCAATTTAATGAGGATT
TAACTGATCCTAGAAACAACAAATAAGCGAAGCAAATTGATAGGAGTGATTCTTCTTCTT
CTTCCTCATCAAATTATCATAATATCAATAATAATGCTAATCGAGAGGTATTAGTTATGG
GTAATAATAATGCTGCTTCAACTTCAAACAATAATAATATAGGGAGATATTTAAGTAAAA
ACAAAGAGATAATGACTTATAATAAAAAAAAGATGTCGTTGATTACTGACAGCAGTATAC
TTAATGATGATAAAAAGAAGAGTGGTAGTACACGTTAGTCAACTACTTAACAAGGAATTA
ATTACTAATCTAACAGCAACAGTCAAGCAACCAACGATGAAAAGAAATAAAATTAAAATG
AAGATAAAAAACTGAAATTAGATTTATAAACATAACAGTAACAGTCTTATTTGCCTACCC
ACAAAGTAAACTCTTAAAGCCAATAAATTTAAAAATCAAATCAAATTTTAAGCTCATAAC
ACTCTCCATTGGAGAATCCTTTAAATTCACATAGAGTTTTAACTTAAGCTACAGAAAAAT
AAGCAGAAAAAAACTATAGTAGTAATAACAATAATGTTTCAGGCGGAGAGTTTAATCAAA
AAGCTAATTAATACCATGTTTAAGGTAAATCTTAAAATAAAAATAAAAATGATGAGTAGG
AATTGGAACAAAAAAAGAGGATTTAGAGCTCTCTAGATGAAGGTTTAATGGTATAAGAAA
AAATAAAATAGAGCAAAGAAAACACTCCTGGAAATAGTTAAAATAATAAAGATATAAAAG
CTTCTCTTGAATAAAAGTAAAAAGATACAATAAACCATCCTCAATAGTAGTAGTAGTAGT
AGTAGTAGTAGTAGCAGAAATTGATCTCTTAGCCTAGTAATTTAAAGGACACAAAAGAAA
CAAAAGAAATTAAAGAATATCTTAAAGATATTAACAGTAATAATAATATAAACAATAATG
CTTCTAATAAAAATAATGAGATTAAAGGTCAAAATCCTTTAGTTGCTTATTTCAATATCA
GCAAATCAATGAGTGATAATTTACAAAGTAATTTTAAAATTCGTCCTTTTTCAGCATAAA
CGAAACCTAGATAAAATGAATTAGCTAAAAAACCAGAAGTTAATAATTTTATTAAGAATG
AAATGATTTCAAGCTAAACTAAAGATGCTATGAAATTGGAGTAAATAATCAAAGAATTTA
AATAGGAAGCTCAAAAAATTAGAGAGGCACCACTAATTATTTACTCAAATGGTTAAAATC
AGCCATAAACTACTCCTAAGGATCATAAAAATTCAATCGAAACTAAAAAGAACGATAAAA
ATACTAATAATGGGCCACATTAGAGTTCTTCAACTCAGTCTAACAAAAAAGAGCCTTCCA
ACCAGTAGTCACAATAAAATAAAAATGTGAACTAAAATGATATTAAAACAGAAAACAAAA
GGAAAGAAGACAATAATTTAGGAAATGAAAATGTAATCAGACCATAGTCAGCTCATCCTT
TAGTAGGAAATAGATAGAATAAAGTCTTTAATTAGTTTAATAACAGATATGTATCACCAA
ATTAATATATAGCAGGATTCAGTAGTCCGTTCTAGAGCAACCCAAATACAAATACATCTC
ATAAATCTATTGTAAATAATTTTATTAAAAACAGCATAGGCAAAATGAACAATAATGTTA
TTATAGATCCTGTAACTAAACCATAAAAAGGTAAATTATATTGGAATAATCTAAGCAATT
TATTGATTTATTTTTTACTTTTATAATAAACAGATTAAAACTAAAATTAAGAAAATGATA
AAAATTACTTCTTTTATAGAATTGACAACGTATAAAGAGATTTTAATGAAGAAAGTAAGT
TTTTATTCAAAAATAAATAAAATATTAATTTTTAAAACCAAATAATAAAAGTAAATCCTT
AATCTACCAAATCTAGTTCATAAAAAATGGATTTAACTTCAAAGATTAAATCAGCAACTT
CTACCAATTTTTATAAGGAATAATCTTAAATGACCGTAAGTGTTAAGGGAGGAAATTCTT
AAAATCTTGATAATCCACAATAACAGTAAAATAAAGAAAAGTAAAGTTAAGGAAAAGTTT
TAGTATTAAACAATGCTCGCCCATAAACTTCAACAGGTGTAAGAAAAAAGTATACAATTA
AAGATTTAGTATCTGATTAACATGTATTTCGCACTAACTAAGTAGTGAGTCAATGA