Identifiers and Description

Gene Model Identifier

TTHERM_00412080

Standard Name

NRK33 (NIMA-Related Kinase )

Aliases

PreTt21626 | 44.m00293 | 3714.m00139

Description

Protein kinase domain containing protein. Sequence similarity to the NEK protein kinase family (Eisen et al., 2006)."

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00412080

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10393.19.997093137033517e-262protein kinase domain-containi
ng protein (1143 aa)
OxytrichaContig544.1.g86.000414531663983e-92Protein kinase domain
DictyBaseDDB_G02752412.0008958828286524e-54nek3 on chromosome: 2 position
4983790 to 4987279
WormBaseWBGene000089561.0002546821282671e-50locus:nekl-3 status:Confirme
d UniProt:G5EFM9 protein_i
d:CAA92169.2
Stentor CoeruleusSteCoe_107171.0112214926104486e-43
SGDYAR018C3.998777993244535e-41KIN3 Nonessential serine/threo
nine protein kinase; possible
role in DNA damage response

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16611747: Wloga D, Camba A, Rogowski K, Manning G, Jerka-Dziadosz M, Gaertig J (2006) Members of the NIMA-related kinase family promote disassembly of cilia by multiple mechanisms. Molecular biology of the cell 17(6):2799-810

Sequences

>TTHERM_00412080(coding)
ATGAATACAAACAATCGATAGTAAAGATCTGAATCTGATAAAGAAAAAGCACGTTTGATG
AATGGTGTAGATATCAATTCAGAAAAATAGGAGCACGAAGACAATAAGCGATAAATAGGA
TCATGTGTTTCTGATTTTACTATAGTGAAGGAATTAGGTAGAGGTTCGTATGGTGTAGTG
TATAGAGCAATATCTAATATCAACAAAAAAGAGTATGTAGTGAAGAAAATAAATATCAAA
CACATGAGTAATAAGCATTAAAAAGAAGCTCTTAAGGAGGCGCAAATTCTACGTAAAGTC
AGACATGAAAATATTATCAGATACTACACTTCTTTTGTAGAGCATGATTGTCTTTATATA
GTGATGGAATACGCAGATGGAGGTGATCTTTAATAACTTCTTAGATATCGTAGAGAGAGA
AAAAAATAGTTTACCGAAACAGAAATATGGGAATTTGCTTATGATTTGATTAAAGCAGTT
GATTATTTGCATAAAAATAATATAATACATAGAGATATCAAGACATTAAATATATTTCTC
ACTAAAGATAGAAAAGTCAAGTTAGGTGACTTAGGTGTCTCTAAAATAGTATCAAGCCAA
GCTGCATTGTAAGGAACTAGAGTAGGTACTCCTCTGTATCTTGCTCCTGAGCTTGTTAAA
TAGTAACCATACGATTTTAAAGTAGATATTTGGGCAATTGGAATAGTGCTATATCACATT
AGCGCTCTTGAGCCACCATTTTAAGGAGAGAATTTAATTGCTTTAGGGTTTAATATAGTC
CATAAATTTCCGAAGCCATTGCCAAGTGTTTATTCTCCAAAACTTGTTAGCTTTATTAAT
AAGCTGCTAGAAAAGAATCCACTTTAGCGTCCAAAGACATCGGAATTAATTGAAACATTT
CCTAAAAAGAGTGAAAGACCCATGACGGGATAACCATAAAATTCTAATTCTTGGTAAAAT
AATGCTCTAAAAAACTCTTCAAGCTAGGTTATCAATGATAAGATTGAAGTATATGATAAG
GGGAATTATAATATGCTAAATAGAATTATAGAAGAAGATTAAGAAATGGCTGCAGCATTT
CAACACAAGATAGATAATAATAAAAGATCTTTAGAATTAAATGACTTTGATAATAAAATA
CAGGGTCAACCATCAGTATTACCTTATCATATGAGAAGACCTTAAACAAGTGTTGGTAGA
GATAAGGAAAAGCTGTTATATTAGCAAAGAATGTAAGAAAATATTAACAACGAATATAAT
AATCTAAATGTTAAATCATACAAAAATAATGCAAATTAAATAGATAATTAACAAGACTTA
AAAAACCAATTTAATGAGGATTTAACTGATCCTAGAAACAACAAATAAGCGAAGCAAATT
GATAGGAGTGATTCTTCTTCTTCTTCCTCATCAAATTATCATAATATCAATAATAATGCT
AATCGAGAGGTATTAGTTATGGGTAATAATAATGCTGCTTCAACTTCAAACAATAATAAT
ATAGGGAGATATTTAAGTAAAAACAAAGAGATAATGACTTATAATAAAAAAAAGATGTCG
TTGATTACTGACAGCAGTATACTTAATGATGATAAAAAGAAGAGTGGTAGTACACGTTAG
TCAACTACTTAACAAGGAATTAATTACTAATCTAACAGCAACAGTCAAGCAACCAACGAT
GAAAAGAAATAAAATTAAAATGAAGATAAAAAACTGAAATTAGATTTATAAACATAACAG
TAACAGTCTTATTTGCCTACCCACAAAGTAAACTCTTAAAGCCAATAAATTTAAAAATCA
AATCAAATTTTAAGCTCATAACACTCTCCATTGGAGAATCCTTTAAATTCACATAGAGTT
TTAACTTAAGCTACAGAAAAATAAGCAGAAAAAAACTATAGTAGTAATAACAATAATGTT
TCAGGCGGAGAGTTTAATCAAAAAGCTAATTAATACCATGTTTAAGGTAAATCTTAAAAT
AAAAATAAAAATGATGAGTAGGAATTGGAACAAAAAAAGAGGATTTAGAGCTCTCTAGAT
GAAGGTTTAATGGTATAAGAAAAAATAAAATAGAGCAAAGAAAACACTCCTGGAAATAGT
TAAAATAATAAAGATATAAAAGCTTCTCTTGAATAAAAGTAAAAAGATACAATAAACCAT
CCTCAATAGTAGTAGTAGTAGTAGTAGTAGTAGTAGCAGAAATTGATCTCTTAGCCTAGT
AATTTAAAGGACACAAAAGAAACAAAAGAAATTAAAGAATATCTTAAAGATATTAACAGT
AATAATAATATAAACAATAATGCTTCTAATAAAAATAATGAGATTAAAGGTCAAAATCCT
TTAGTTGCTTATTTCAATATCAGCAAATCAATGAGTGATAATTTACAAAGTAATTTTAAA
ATTCGTCCTTTTTCAGCATAAACGAAACCTAGATAAAATGAATTAGCTAAAAAACCAGAA
GTTAATAATTTTATTAAGAATGAAATGATTTCAAGCTAAACTAAAGATGCTATGAAATTG
GAGTAAATAATCAAAGAATTTAAATAGGAAGCTCAAAAAATTAGAGAGGCACCACTAATT
ATTTACTCAAATGGTTAAAATCAGCCATAAACTACTCCTAAGGATCATAAAAATTCAATC
GAAACTAAAAAGAACGATAAAAATACTAATAATGGGCCACATTAGAGTTCTTCAACTCAG
TCTAACAAAAAAGAGCCTTCCAACCAGTAGTCACAATAAAATAAAAATGTGAACTAAAAT
GATATTAAAACAGAAAACAAAAGGAAAGAAGACAATAATTTAGGAAATGAAAATGTAATC
AGACCATAGTCAGCTCATCCTTTAGTAGGAAATAGATAGAATAAAGTCTTTAATTAGTTT
AATAACAGATATGTATCACCAAATTAATATATAGCAGGATTCAGTAGTCCGTTCTAGAGC
AACCCAAATACAAATACATCTCATAAATCTATTGTAAATAATTTTATTAAAAACAGCATA
GGCAAAATGAACAATAATGTTATTATAGATCCTGTAACTAAACCATAAAAAGATTAAAAC
TAAAATTAAGAAAATGATAAAAATTACTTCTTTTATAGAATTGACAACGTATAAAGAGAT
TTTAATGAAGAAATAAATCCTTAATCTACCAAATCTAGTTCATAAAAAATGGATTTAACT
TCAAAGATTAAATCAGCAACTTCTACCAATTTTTATAAGGAATAATCTTAAATGACCGTA
AGTGTTAAGGGAGGAAATTCTTAAAATCTTGATAATCCACAATAACAGTAAAATAAAGAA
AAGTAAAGTTAAGGAAAAGTTTTAGTATTAAACAATGCTCGCCCATAAACTTCAACAGGT
GTAAGAAAAAAGTATACAATTAAAGATTTAGTATCTGATTAACATGTATTTCGCACTAAC
TAAGTAGTGAGTCAATGA


>TTHERM_00412080(protein)
MNTNNRQQRSESDKEKARLMNGVDINSEKQEHEDNKRQIGSCVSDFTIVKELGRGSYGVV
YRAISNINKKEYVVKKINIKHMSNKHQKEALKEAQILRKVRHENIIRYYTSFVEHDCLYI
VMEYADGGDLQQLLRYRRERKKQFTETEIWEFAYDLIKAVDYLHKNNIIHRDIKTLNIFL
TKDRKVKLGDLGVSKIVSSQAALQGTRVGTPLYLAPELVKQQPYDFKVDIWAIGIVLYHI
SALEPPFQGENLIALGFNIVHKFPKPLPSVYSPKLVSFINKLLEKNPLQRPKTSELIETF
PKKSERPMTGQPQNSNSWQNNALKNSSSQVINDKIEVYDKGNYNMLNRIIEEDQEMAAAF
QHKIDNNKRSLELNDFDNKIQGQPSVLPYHMRRPQTSVGRDKEKLLYQQRMQENINNEYN
NLNVKSYKNNANQIDNQQDLKNQFNEDLTDPRNNKQAKQIDRSDSSSSSSSNYHNINNNA
NREVLVMGNNNAASTSNNNNIGRYLSKNKEIMTYNKKKMSLITDSSILNDDKKKSGSTRQ
STTQQGINYQSNSNSQATNDEKKQNQNEDKKLKLDLQTQQQQSYLPTHKVNSQSQQIQKS
NQILSSQHSPLENPLNSHRVLTQATEKQAEKNYSSNNNNVSGGEFNQKANQYHVQGKSQN
KNKNDEQELEQKKRIQSSLDEGLMVQEKIKQSKENTPGNSQNNKDIKASLEQKQKDTINH
PQQQQQQQQQQQQKLISQPSNLKDTKETKEIKEYLKDINSNNNINNNASNKNNEIKGQNP
LVAYFNISKSMSDNLQSNFKIRPFSAQTKPRQNELAKKPEVNNFIKNEMISSQTKDAMKL
EQIIKEFKQEAQKIREAPLIIYSNGQNQPQTTPKDHKNSIETKKNDKNTNNGPHQSSSTQ
SNKKEPSNQQSQQNKNVNQNDIKTENKRKEDNNLGNENVIRPQSAHPLVGNRQNKVFNQF
NNRYVSPNQYIAGFSSPFQSNPNTNTSHKSIVNNFIKNSIGKMNNNVIIDPVTKPQKDQN
QNQENDKNYFFYRIDNVQRDFNEEINPQSTKSSSQKMDLTSKIKSATSTNFYKEQSQMTV
SVKGGNSQNLDNPQQQQNKEKQSQGKVLVLNNARPQTSTGVRKKYTIKDLVSDQHVFRTN
QVVSQ


>TTHERM_00412080(gene)
ATGAATACAAACAATCGATAGTAAAGATCTGAATCTGATAAAGAAAAAGCACGTTTGATG
AATGGTGTAGATATCAATTCAGAAAAATAGGAGCACGAAGACAATAAGCGATAAATAGGA
TCATGTGTTTCTGATTTTACTATAGTGAAGGAATTAGGTAGAGGTTCGTATGGTGTAGTG
TATAGAGCAATATCTAATATCAACAAAAAAGAGTATGTAGTGAAGAAAATAAATATCAAA
CACATGAGTAATAAGCATTAAAAAGAAGCTCTTAAGGAGGCGCAAATTCTACGTAAAGTC
AGACATGAAAATATTATCAGATACTACACTTCTTTTGTAGAGCATGATTGTCTTTATATA
GTGATGGAATACGCAGATGGAGGTGATCTTTAATAAGTTAATACATAAATATTATTTCTA
TTATTCTATGGTTCAAATACATTTTTAAATATCAATTCAGTAATTCTTAAATCATGCAAG
CCATTATATTTATTATCCATTGTTATTAGGATGATACTTTGATCTGAAAATCACCAAAAA
AATAATATTTCTAAAAAAAAGTTACAGCATCATCAATTAAATTTATTGTATTTTGGATTA
CCTATCGCTTGCTAATTAATTTAAATGAATAATTAAAAAATTTTTCACTGAAACTGATTA
ATAAATGTAAATAATTTTAAAAAAATAGCTTCTTAGATATCGTAGAGAGAGAAAAAAATA
GTTTACCGAAACAGAAATATGGGAATTTGCTTATGATTTGATTAAAGCAGTTGATTATTT
GCATAAAAATAATATAATACATAGAGATATCAAGACATTAAATATATTTCTCACTAAAGA
TAGAAAAGTCAAGGTAAAAATTCTATCAATTTGACTGATTTAAATTAAACTAATTGATCG
TTTTCAATTATAATACATTGCTAATTTTTATATTTTAATAGGATTTATTTATTTATTTTT
CATTTTTGTCAAAAGAAATGAAAAGGAATTTTTTGTAGATTATTTTATCTATATTTAGAT
TTATAATTTAATTTCACTTTATTCAAAACTCAAACAATTAAATAAGCTATTAAAACTTCT
TCTTTTAATAGTTAGGTGACTTAGGTGTCTCTAAAATAGTATCAAGCCAAGCTGCATTGT
AAGGAACTAGAGTAGGTACTCCTCTGTATCTTGCTCCTGAGCTTGTTAAATAGTAACCAT
ACGATTTTAAAGTAAATTAATTAATAATTTATAATTAGTTAAAATCAATAATTTTAAAAT
AATTAGGTAGATATTTGGGCAATTGGAATAGTGCTATATCACATTAGCGGTAATTTATTT
ATTTTTTTAATAAGTACTTATTTTAAAATGTTAATAAAATAGCTCTTGAGCCACCATTTT
AAGGAGAGAATTTAATTGCTTTAGGGTTTAATATAGTCCATAAATTTCCGAAGCCATTGC
CAAGTGTTTATTCTCCAAAACTTGTTAGCTTTATTAATAAGCTGCTAGAAAAGAATCCAC
TTTAGCGTCCAAAGACATCGGAATTAATTGAAACATTTCCTAAAAAGAGTGAAAGACCCA
TGACGGGATAACCATAAAATTCTAATTCTTGGTAAAATAATGCTCTAAAAAACTCTTCAA
GCTAGGTTATCAATGATAAGATTGAAGTATATGATAAGGGGAATTATAATATGCTAAATA
GAATTATAGAAGAAGATTAAGAAATGGCTGCAGCATTTCAACACAAGATAGATAATAATA
AAAGATCTTTAGAATTAAATGACTTTGATAATAAAATACAGGGTCAACCATCAGTATTAC
CTTATCATATGAGAAGACCTTAAACAAGTGTTGGTAGAGATAAGGAAAAGCTGTTATATT
AGCAAAGAATGTAAGAAAATATTAACAACGAATATAATAATCTAAATGTTAAATCATACA
AAAATAATGCAAATTAAATAGATAATTAACAAGACTTAAAAAACCAATTTAATGAGGATT
TAACTGATCCTAGAAACAACAAATAAGCGAAGCAAATTGATAGGAGTGATTCTTCTTCTT
CTTCCTCATCAAATTATCATAATATCAATAATAATGCTAATCGAGAGGTATTAGTTATGG
GTAATAATAATGCTGCTTCAACTTCAAACAATAATAATATAGGGAGATATTTAAGTAAAA
ACAAAGAGATAATGACTTATAATAAAAAAAAGATGTCGTTGATTACTGACAGCAGTATAC
TTAATGATGATAAAAAGAAGAGTGGTAGTACACGTTAGTCAACTACTTAACAAGGAATTA
ATTACTAATCTAACAGCAACAGTCAAGCAACCAACGATGAAAAGAAATAAAATTAAAATG
AAGATAAAAAACTGAAATTAGATTTATAAACATAACAGTAACAGTCTTATTTGCCTACCC
ACAAAGTAAACTCTTAAAGCCAATAAATTTAAAAATCAAATCAAATTTTAAGCTCATAAC
ACTCTCCATTGGAGAATCCTTTAAATTCACATAGAGTTTTAACTTAAGCTACAGAAAAAT
AAGCAGAAAAAAACTATAGTAGTAATAACAATAATGTTTCAGGCGGAGAGTTTAATCAAA
AAGCTAATTAATACCATGTTTAAGGTAAATCTTAAAATAAAAATAAAAATGATGAGTAGG
AATTGGAACAAAAAAAGAGGATTTAGAGCTCTCTAGATGAAGGTTTAATGGTATAAGAAA
AAATAAAATAGAGCAAAGAAAACACTCCTGGAAATAGTTAAAATAATAAAGATATAAAAG
CTTCTCTTGAATAAAAGTAAAAAGATACAATAAACCATCCTCAATAGTAGTAGTAGTAGT
AGTAGTAGTAGTAGCAGAAATTGATCTCTTAGCCTAGTAATTTAAAGGACACAAAAGAAA
CAAAAGAAATTAAAGAATATCTTAAAGATATTAACAGTAATAATAATATAAACAATAATG
CTTCTAATAAAAATAATGAGATTAAAGGTCAAAATCCTTTAGTTGCTTATTTCAATATCA
GCAAATCAATGAGTGATAATTTACAAAGTAATTTTAAAATTCGTCCTTTTTCAGCATAAA
CGAAACCTAGATAAAATGAATTAGCTAAAAAACCAGAAGTTAATAATTTTATTAAGAATG
AAATGATTTCAAGCTAAACTAAAGATGCTATGAAATTGGAGTAAATAATCAAAGAATTTA
AATAGGAAGCTCAAAAAATTAGAGAGGCACCACTAATTATTTACTCAAATGGTTAAAATC
AGCCATAAACTACTCCTAAGGATCATAAAAATTCAATCGAAACTAAAAAGAACGATAAAA
ATACTAATAATGGGCCACATTAGAGTTCTTCAACTCAGTCTAACAAAAAAGAGCCTTCCA
ACCAGTAGTCACAATAAAATAAAAATGTGAACTAAAATGATATTAAAACAGAAAACAAAA
GGAAAGAAGACAATAATTTAGGAAATGAAAATGTAATCAGACCATAGTCAGCTCATCCTT
TAGTAGGAAATAGATAGAATAAAGTCTTTAATTAGTTTAATAACAGATATGTATCACCAA
ATTAATATATAGCAGGATTCAGTAGTCCGTTCTAGAGCAACCCAAATACAAATACATCTC
ATAAATCTATTGTAAATAATTTTATTAAAAACAGCATAGGCAAAATGAACAATAATGTTA
TTATAGATCCTGTAACTAAACCATAAAAAGGTAAATTATATTGGAATAATCTAAGCAATT
TATTGATTTATTTTTTACTTTTATAATAAACAGATTAAAACTAAAATTAAGAAAATGATA
AAAATTACTTCTTTTATAGAATTGACAACGTATAAAGAGATTTTAATGAAGAAAGTAAGT
TTTTATTCAAAAATAAATAAAATATTAATTTTTAAAACCAAATAATAAAAGTAAATCCTT
AATCTACCAAATCTAGTTCATAAAAAATGGATTTAACTTCAAAGATTAAATCAGCAACTT
CTACCAATTTTTATAAGGAATAATCTTAAATGACCGTAAGTGTTAAGGGAGGAAATTCTT
AAAATCTTGATAATCCACAATAACAGTAAAATAAAGAAAAGTAAAGTTAAGGAAAAGTTT
TAGTATTAAACAATGCTCGCCCATAAACTTCAACAGGTGTAAGAAAAAAGTATACAATTA
AAGATTTAGTATCTGATTAACATGTATTTCGCACTAACTAAGTAGTGAGTCAATGA