Identifiers and Description

Gene Model Identifier

TTHERM_00809380

Standard Name

NRK31 (NIMA-Related Kinase)

Aliases

PreTt23433 | 137.m00127

Description

Protein kinase domain containing protein. Sequence similarity to the NEK protein kinase family (Eisen et al., 2006)."

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00809380

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01377.19.997093137033517e-262protein kinase domain-containi
ng protein (803 aa)
OxytrichaContig4483.0.g302.000277046697593e-115Protein kinase domain
DictyBaseDDB_G02752411.9992362000979228e-56nek3 on chromosome: 2 position
4983790 to 4987279
Stentor CoeruleusSteCoe_110573.817497188671175e-54
WormBaseWBGene000089561.000159011384939e-43locus:nekl-3 status:Confirme
d UniProt:G5EFM9 protein_i
d:CAA92169.2
SGDYAR018C3.001129784945559e-41KIN3 Nonessential serine/threo
nine protein kinase; possible
role in DNA damage response

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16611747: Wloga D, Camba A, Rogowski K, Manning G, Jerka-Dziadosz M, Gaertig J (2006) Members of the NIMA-related kinase family promote disassembly of cilia by multiple mechanisms. Molecular biology of the cell 17(6):2799-810

Sequences

>TTHERM_00809380(coding)
ATGAATAAAGACTACTATTAAAATAACAACTACTACAAGTATGGTCACTAGAATAACAAT
TTTAACACCACAATGAGTCAAACGACTCTTAAAGACTTTGAGGTCATATCTAAGTTAGGA
GAAGGTTCTTTTTCATAGGTTTTTTAAGTGAAGAGAAAGTCTGATGGCATGATTTATGCC
ATGAAGAAAGTAAAAATGGGTTTATTGAAAGAAAAGGAAAAAGAAAATGCTCTCAATGAA
GTTCGTATATTAGCTTCATTGAACGACGAATTTATAGTCGGGTATAAAGAAGCATTCATA
GATGAATAGTCCTAAATTCTTTGTGTTGTTATGGAATATGCAGCAGGAGGAGATTTACAA
GGTAAAATCACTGCAAACATCAAAAGCAAGACAATGTTCCCAGAAAGCGAAGTTTGGAAA
GCTTTAATTCATATGTCAAAAGGATTGCAAATTCTTCACTAAATGCAGATTCTTCATAGA
GATCTTAAGTGTGCAAATGTTTTTCTTTCTTTAGAAGGAGTCTACAAGTTAGGTGATTTA
AACGTATCAAAAGTAGCCAAAAAAGGATTAGTTTATACATAAACAGGAACACCATATTAT
GCATCTCCTGAAGTTTGGAGAGACGAACCTTACGATGTCAAAAGCGATATCTGGTCCTTA
GGTTGTGTACTTTACGAAATGTGTGCTCTAAAACCACCTTTTAGGGCTAATGATATGGAA
GGACTATATAAAAAAGTATAAAAAGGAGACTTCGAACGTATACCCAAAAAGTATTCTGAA
GATTTATAGAGAATGTTAACTATGCTTTTGAAAGTGAATCCAAAAGACAGACCAAGCTGT
GAACAAATTCTATCAAATCCTATTGTTTAAAGAAATGGAGGTGAAGATGCATAGTAAAGA
CCACCATCAAATAAAAAATTAGTGAAAAAGTCTTCAAAAGCTGAACTTTTGTAAACAATT
TAACTTCCAAAGAATTTAGGATTACTTAAGGGAAAATTGCCAAAAGCCAATTATAAAAAA
GCTGAGTCAATAGATGATATAGAGCTTGATTATGAGAATGAAGAAAAAGAATAGCTGCAA
CAATAGTTAAAAAAGACAAATAGAATAGTAAGTGCAGGTGTTCGCCGTACAGAAAATTAT
GTCAATAATTTAGGAAATAGAAATAATTTACCTGCTCCTCTAGTTAAATAGCCATCTAGT
AACGAAGTAAAGCATCCTCTTTTAGCAAAAGATATCACGCCATTGTAATAGAAATAATAA
CAATAATATGAAGTACCCAGCAACTACAACCCCTCAAACCTTTCAAATAATGCTTCTAAT
GTTAATTAAAATGGGTAACCCACTGGAATAAAGCCTAGAGTTTTAGGTAGACCTATTAGT
GGTGTTGTATAAACGAAAAATAATATTCCTCCATTGAGTCCTATCCAAGGTCTTGCTAAA
GTAAAGCCTACACTCAGTAGACCAACATCTGGGGCTAGTATAAATTAAATCAATGGAGTA
AATTACAATAAAGACTATAATAGCAACAAAGTTAATGCTGTTAATGAGCCAATAAAACCC
ACTAATCAGTATTATTCTAATTAACCTTAATAAATCGTAAATAGGAATTAAATCAATAAT
GAACCTGTGATAACCAACAACAACCCATACAGGAATGTTGCTGATAGATACGAAATACCC
TCAAGCAATAATAACTACAACAATATAAATAATAATAGATATTCTGCTTTAAATAACAAT
GGCGCTTATTCTAAAAATTTAACTCCTCAGCAGTATTTGATGAAATAACAAAATAACTAC
AATGAACTATATAGCAAATACTAAAACACACCCTCATCAGCAAACGCAAAGTATGAAGAT
TTGAATACAAAATTAGCTATGAAGGAGAAAGCCCTCTTAGGTGGAGGAGGAGGAGTGAGT
TAAAGTCATAATGTGAATGCGATTGCAGATAAATATAGTAATAACAATAACTAATACAAT
ATTCAAAGAATATATTCAGAATAAAATGTCATGAATTATGCAAAACCCTAAAGAATTTAG
TCATCAAAGCCTTATGTAAATAACAACAACAATTACAATTATGACATTTACTAAAAAGAA
AGCAATATTCAATAGCAATATAAATCGCCATAATATGGATAGTACAACAACAATAATAAT
AATAATAATTATAATGTAGCAAGCAATAATAACAACAACATTGTTAATAACAGTAAAGCT
TATGACCCATCTAATTATATGTATGGAAGAAGACAGTAAAGTGCTAATATAATTGCTTAA
GCAAGAAATTAAGTCTATGGAAACTAATAAGCCTATTAAATGCCAATTTAGCCTGTTAAT
AACATTCAACCTGTGAATAGATAAGCACCAGTAAGCAGACCTGTTTGGTGGGGTTGA


>TTHERM_00809380(protein)
MNKDYYQNNNYYKYGHQNNNFNTTMSQTTLKDFEVISKLGEGSFSQVFQVKRKSDGMIYA
MKKVKMGLLKEKEKENALNEVRILASLNDEFIVGYKEAFIDEQSQILCVVMEYAAGGDLQ
GKITANIKSKTMFPESEVWKALIHMSKGLQILHQMQILHRDLKCANVFLSLEGVYKLGDL
NVSKVAKKGLVYTQTGTPYYASPEVWRDEPYDVKSDIWSLGCVLYEMCALKPPFRANDME
GLYKKVQKGDFERIPKKYSEDLQRMLTMLLKVNPKDRPSCEQILSNPIVQRNGGEDAQQR
PPSNKKLVKKSSKAELLQTIQLPKNLGLLKGKLPKANYKKAESIDDIELDYENEEKEQLQ
QQLKKTNRIVSAGVRRTENYVNNLGNRNNLPAPLVKQPSSNEVKHPLLAKDITPLQQKQQ
QQYEVPSNYNPSNLSNNASNVNQNGQPTGIKPRVLGRPISGVVQTKNNIPPLSPIQGLAK
VKPTLSRPTSGASINQINGVNYNKDYNSNKVNAVNEPIKPTNQYYSNQPQQIVNRNQINN
EPVITNNNPYRNVADRYEIPSSNNNYNNINNNRYSALNNNGAYSKNLTPQQYLMKQQNNY
NELYSKYQNTPSSANAKYEDLNTKLAMKEKALLGGGGGVSQSHNVNAIADKYSNNNNQYN
IQRIYSEQNVMNYAKPQRIQSSKPYVNNNNNYNYDIYQKESNIQQQYKSPQYGQYNNNNN
NNNYNVASNNNNNIVNNSKAYDPSNYMYGRRQQSANIIAQARNQVYGNQQAYQMPIQPVN
NIQPVNRQAPVSRPVWWG


>TTHERM_00809380(gene)
ATGAATAAAGACTACTATTAAAATAACAACTACTACAAGTATGGTCACTAGAATAACAAT
TTTAACACCACAATGAGTCAAACGACTCTTAAAGACTTTGAGGTCATATCTAAGTTAGGA
GAAGGTTCTTTTTCATAGGTTTTTTAAGTGAAGAGAAAGTCTGATGGCATGATTTATGCC
ATGAAGAAAGTAAAAATGGGTTTATTGAAAGAAAAGGAAAAAGAAAATGCTCTCAATGAA
GTTCGTATATTAGCTTCATTGAACGACGAATTTATAGTCGGGTATAAAGAAGCATTCATA
GATGAATAGTCCTAAATTCTTTGTGTTGTTATGGAATATGCAGCAGGAGGAGATTTACAA
GGTAAAATCACTGCAAACATCAAAAGCAAGACAATGTTCCCAGAAAGCGAAGTTTGGAAA
GCTTTAATTCATATGTCAAAAGGATTGCAAATTCTTCACTAAATGCAGATTCTTCATAGA
GATCTTAAGTGTGCAAATGTTTTTCTTTCTTTAGAAGGAGTCTACAAGTTAGGTAAAACA
ATAAATAATGCTTAAAATTTATCAAATAAAAGATCCATTACAAACATTTTCTGCAAATAT
ATTTTTGCTTAACTTTAAAAAATACTCATTTTTGTTTATAAAAGACTTGCTTGTTTGTTT
AATAATAAATAATAGACTTAAGAAATTTAAAAATTTGATACAATTTTAAATAGAATTTAA
TCATTTTATTAACATAACAAATAAATAGGTGATTTAAACGTATCAAAAGTAGCCAAAAAA
GGATTAGTTTATACATAAACAGGAACACCATATTATGCATCTCCTGAAGTTTGGAGAGAC
GAACCTTACGATGTCAAAAGCGATATCTGGTCCTTAGGTTGTGTACTTTACGAAATGTGT
GCTCTAAAACCACCTTTTAGGGCTAATGATATGGAAGGACTATATAAAAAAGTATAAAAA
GGAGACTTCGAACGTATACCCAAAAAGTAATAGACAATCATTTATCATTTTTAATTAATA
ATTGAATGAGTTCAAGTTATAAAATTCATAATTCTCTATTTCAGAATGGTTTATTTTAGA
TATTTATTTATTCATAATTTAAATACTTAAACGATATTTAGCTAAATTTTATCGTTAACA
AAAGCAAAAATTATTAAATATTGAGATTTTTAAAAATCCTTAAATAAAAAATAAATAATA
AATTAAATTGAATTGAATGAAAAAAATTTTTTTTAATTTAGAATGAATAAAAAGTTAAAG
TTTTGAATAAATTATTAAAAAAAAAATGAAAACTTTGACATTAAAATAATTTTAAAAATT
TAAATTGAATGCAGGTATTCTGAAGATTTATAGAGAATGTTAACTATGCTTTTGAAAGTG
AATCCAAAAGACAGACCAAGCTGTGAACAAATTCTATCAAATCCTATTGTTTAAAGAAAT
GGAGGTGAAGATGCATAGTAAAGACCACCATCAAATAAAAAATTAGTGAAAAAGTCTTCA
AAAGCTGAACTTTTGTAAACAATTTAACTTCCAAAGAATTTAGGATTACTTAAGGGAAAA
TTGCCAAAAGCCAATTATAAAAAAGCTGAGTCAATAGATGATATAGAGCTTGATTATGAG
AATGAAGAAAAAGAATAGCTGCAACAATAGTTAAAAAAGACAAATAGAATAGTAAGTGCA
GGTGTTCGCCGTACAGAAAATTATGTCAATAATTTAGGAAATAGAAATAATTTACCTGCT
CCTCTAGTTAAATAGCCATCTAGTAACGAAGTAAAGCATCCTCTTTTAGCAAAAGATATC
ACGCCATTGTAATAGAAATAATAACAATAATATGAAGTACCCAGCAACTACAACCCCTCA
AACCTTTCAAATAATGCTTCTAATGTTAATTAAAATGGGTAACCCACTGGAATAAAGCCT
AGAGTTTTAGGTAGACCTATTAGTGGTGTTGTATAAACGAAAAATAATATTCCTCCATTG
AGTCCTATCCAAGGTCTTGCTAAAGTAAAGCCTACACTCAGTAGACCAACATCTGGGGCT
AGTATAAATTAAATCAATGGAGTAAATTACAATAAAGACTATAATAGCAACAAAGTTAAT
GCTGTTAATGAGCCAATAAAACCCACTAATCAGTATTATTCTAATTAACCTTAATAAATC
GTAAATAGGAATTAAATCAATAATGAACCTGTGATAACCAACAACAACCCATACAGGAAT
GTTGCTGATAGATACGAAATACCCTCAAGCAATAATAACTACAACAATATAAATAATAAT
AGATATTCTGCTTTAAATAACAATGGCGCTTATTCTAAAAATTTAACTCCTCAGCAGTAT
TTGATGAAATAACAAAATAACTACAATGAACTATATAGCAAATACTAAAACACACCCTCA
TCAGCAAACGCAAAGTATGAAGATTTGAATACAAAATTAGCTATGAAGGAGAAAGCCCTC
TTAGGTGGAGGAGGAGGAGTGAGTTAAAGTCATAATGTGAATGCGATTGCAGATAAATAT
AGTAATAACAATAACTAATACAATATTCAAAGAATATATTCAGAATAAAATGTCATGAAT
TATGCAAAACCCTAAAGAATTTAGTCATCAAAGCCTTATGTAAATAACAACAACAATTAC
AATTATGACATTTACTAAAAAGAAAGCAATATTCAATAGCAATATAAATCGCCATAATAT
GGATAGTACAACAACAATAATAATAATAATAATTATAATGTAGCAAGCAATAATAACAAC
AACATTGTTAATAACAGTAAAGCTTATGACCCATCTAATTATATGTATGGAAGAAGACAG
TAAAGTGCTAATATAATTGCTTAAGCAAGAAATTAAGTCTATGGAAACTAATAAGCCTAT
TAAATGCCAATTTAGCCTGTTAATAACATTCAACCTGTGAATAGATAAGCACCAGTAAGC
AGACCTGTTTGGTGGGGTTGA