Identifiers and Description

Gene Model Identifier

TTHERM_00721400

Standard Name

NRK3 (NIMA-Related Kinase)

Aliases

PreTt18448 | 115.m00104

Description

NIMA-Related Kinase, Protein kinase domain containing protein. Sequence similarity to the NEK protein kinase family (Eisen et al., 2006)."

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00721400

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17477.19.997093137033517e-262protein kinase domain-containi
ng protein (499 aa)
OxytrichaContig16193.0.g776.999576669079256e-104Protein kinase domain
DictyBaseDDB_G02708144.998338612125368e-60nek2 on chromosome: 1 position
4847143 to 4848761
WormBaseWBGene000089565.00115835552873e-49locus:nekl-3 status:Confirme
d UniProt:G5EFM9 protein_i
d:CAA92169.2
Stentor CoeruleusSteCoe_348012.506567475899953e-46
SGDYAR018C1.0002335610448659e-38KIN3 Nonessential serine/threo
nine protein kinase; possible
role in DNA damage response

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16611747: Wloga D, Camba A, Rogowski K, Manning G, Jerka-Dziadosz M, Gaertig J (2006) Members of the NIMA-related kinase family promote disassembly of cilia by multiple mechanisms. Molecular biology of the cell 17(6):2799-810

Sequences

>TTHERM_00721400(coding)
ATGAGTTCAGTTTCATTGAGCGATTTCAACGTTTAAAAAACTTTAGGAAATGGAGCATTT
TCATGGGTATATAAAGTATAGCGCAAACAAGATGGCTAAGTTTACGCTCTTAAAAAGGTT
AAATTGAGGGAACTCTCTTACAAAGAGAAAGAAAATGCTTTAAACGAAATCAGAATTTTA
GCTTCAATAAACTCTCCTCACATTATCAGATACAAAGATGCATTTTATGATAATGCAAGC
GGATGTCTTTGCATTGTGATGGAATATGCAGAGAACGGCGATTTAATGGCTAAATTGCAA
GATTATAAAAAAAGAAACATGTTTATGGACGAGGCAAAAATTTGGAAATATGCAGCATAG
ATTTTACTGGGTTTAAAATCATTGCATGATCTGAAAATTCTTCATCGTGACTTAAAGTGT
GCAAATATTTTCTTGGGTGCTAATAATAAAGTAAAGTTAGGGGATTTAAATGTCTCTAAA
ATTATGAAGAGAGACCTAGCTTACACTCAAACTGGAACACCTTATTACACATCCCCTGAA
GTTTGGTAAAATCAACCATATGATTCAAAGTGTGATGTTTGGAGCATGGGATGTGTTCTA
TATGAATTGATGGCTCATCATCCTCCATTCGAAGCTAAATCCATGGAGGAACTCTATAAG
AAAGTATGTAAAGGCACCTATTAAAAGCTTCCCAAGTAATATAGCCAAGAAATGAATGAC
TTTATTAATCTTTGCTTGAGAAAAAACCCTAAATAACGTCCTTCTGTGAATTCTCTACTA
GAGTTTTAGGGCCTATTGCCTTACGTTTAAAATATATTGGAGAATGAAGAAGATAAAGAA
AATAAGCAACCCAATATTTAGAAAAATAACTCTTTGAATCTTCTATAGACAATGAAAATG
CCTTATGGAAATCTAAATGCTTTAAAAAACATTTTGCCTAAAGCTTAATTTGAAGATTCA
ATAGATTCCTTTATGGAAGAGTAGTCTTTAGCAAAGAAGTCATCTGGAAATAGACCAATC
TCAGCTGTAAACAATAACGATTTTAAAAACAACATTAACTAAAGACATTCACTTGAGCCT
CAACAAGGAAAGTAATAAAATCAATAGCCTAGCTCAAATATTTAAAGACATGCATAGTCT
CCTCCTTCTCATTCTAATTAATAAATTTTGAGCAGTAGACAAAGAATACAATCTGCTCAT
AACGCAATACTATGCCGTTAAGACTCAAATTCCTCAGTTTAAAATTAACTAAAATCCAAT
AATAATAACGTACCAAACGGAATTAATAATTGCCCTTTACCAAAAAGTCCTGAAATTTTA
GGTAGCAAAAAAATATCTGCCTTATAACGTAATGGAATTGAAATGGTTAAGCCCAGAAAT
TCCATCGAAGAAGGAATACCATTAAGAAACGATAGAGAGAGAGGAAGTGTAAATATTCCT
GTAAATAATAACAGATACCCCTCAGCAGGAAGAAGAAACATTTTATGCTGA


>TTHERM_00721400(protein)
MSSVSLSDFNVQKTLGNGAFSWVYKVQRKQDGQVYALKKVKLRELSYKEKENALNEIRIL
ASINSPHIIRYKDAFYDNASGCLCIVMEYAENGDLMAKLQDYKKRNMFMDEAKIWKYAAQ
ILLGLKSLHDLKILHRDLKCANIFLGANNKVKLGDLNVSKIMKRDLAYTQTGTPYYTSPE
VWQNQPYDSKCDVWSMGCVLYELMAHHPPFEAKSMEELYKKVCKGTYQKLPKQYSQEMND
FINLCLRKNPKQRPSVNSLLEFQGLLPYVQNILENEEDKENKQPNIQKNNSLNLLQTMKM
PYGNLNALKNILPKAQFEDSIDSFMEEQSLAKKSSGNRPISAVNNNDFKNNINQRHSLEP
QQGKQQNQQPSSNIQRHAQSPPSHSNQQILSSRQRIQSAHNAILCRQDSNSSVQNQLKSN
NNNVPNGINNCPLPKSPEILGSKKISALQRNGIEMVKPRNSIEEGIPLRNDRERGSVNIP
VNNNRYPSAGRRNILC


>TTHERM_00721400(gene)
ATGAGTTCAGTTTCATTGAGCGATTTCAACGTTTAAAAAACTTTAGGAAATGGAGCATTT
TCATGGGTATATAAAGTATAGCGCAAACAAGATGGCTAAGTTTACGCTCTTAAAAAGGTT
AAATTGAGGGAACTCTCTTACAAAGAGAAAGAAAATGCTTTAAACGAAATCAGAATTTTA
GCTTCAATAAACTCTCCTCACATTATCAGATACAAAGATGCATTTTATGATAATGCAAGC
GGATGTCTTTGCATTGTGATGGAATATGCAGAGAACGGCGATTTAATGGCTAAATTGCAA
GATTATAAAAAAAGAAACATGTTTATGGACGAGGCAAAAATTTGGAAATATGCAGCATAG
ATTTTACTGGGTTTAAAATCATTGCATGATCTGAAAATTCTTCATCGTGACTTAAAGTGT
GCAAATATTTTCTTGGGTGCTAATAATAAAGTAAAGTTAGGGGATTTAAATGTCTCTAAA
ATTATGAAGAGAGACCTAGCTTACACTCAAACTGGAACACCTTATTACACATCCCCTGAA
GTTTGGTAAAATCAACCATATGATTCAAAGTGTGATGTTTGGAGCATGGGATGTGTTCTA
TATGAATTGATGGCTCATCATCCTCCATTCGAAGCTAAATCCATGGAGGAACTCTATAAG
AAAGTATGTAAAGGCACCTATTAAAAGCTTCCCAAGTAATATAGCCAAGAAATGAATGAC
TTTATTAATCTTTGCTTGAGAAAAAACCCTAAATAACGTCCTTCTGTGAATTCTCTACTA
GAGTTTTAGGGCCTATTGCCTTACGTTTAAAATATATTGGAGAATGAAGAAGATAAAGAA
AATAAGCAACCCAATATTTAGAAAAATAACTCTTTGAATCTTCTATAGACAATGAAAATG
CCTTATGGAAATCTAAATGCTTTAAAAAACATTTTGCCTAAAGCTTAATTTGAAGATTCA
ATAGATTCCTTTATGGAAGAGTAGTCTTTAGCAAAGAAGTCATCTGGAAATAGACCAATC
TCAGCTGTAAACAATAACGATTTTAAAAACAACATTAACTAAAGACATTCACTTGAGCCT
CAACAAGGAAAGTAATAAAATCAATAGCCTAGCTCAAATATTTAAAGACATGCATAGTCT
CCTCCTTCTCATTCTAATTAATAAATTTTGAGCAGTAGACAAAGAATACAATCTGCTCAT
AACGCAATACTATGCCGTTAAGACTCAAATTCCTCAGTTTAAAATTAACTAAAATCCAAT
AATAATAACGTACCAAACGGAATTAATAATTGCCCTTTACCAAAAAGTCCTGAAATTTTA
GGTAGCAAAAAAATATCTGCCTTATAACGTAATGGAATTGAAATGGTTAAGCCCAGAAAT
TCCATCGAAGAAGGAATACCATTAAGAAACGATAGAGAGAGAGGAAGTGTAAATATTCCT
GTAAATAATAACAGATACCCCTCAGCAGGAAGAAGAAACATTTTATGCTGA