Identifiers and Description

Gene Model Identifier

TTHERM_00721400

Standard Name

NRK3 (NIMA-Related Kinase)

Aliases

PreTt18448 | 115.m00104

Description

NRK3 plant dual-specificity MAP kinase kinase family domain protein; NIMA-Related Kinase- Protein kinase domain containing protein. Sequence similarity to the NEK protein kinase family (Eisen et al.- 2006).

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00721400

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17477.19.997093137033517e-262protein kinase domain-containi
ng protein (499 aa)
OxytrichaContig16193.0.g776.999576669079256e-104Protein kinase domain
DictyBaseDDB_G02708144.998338612125368e-60nek2 on chromosome: 1 position
4847143 to 4848761
WormBaseWBGene000089565.00115835552873e-49locus:nekl-3 status:Confirme
d UniProt:G5EFM9 protein_i
d:CAA92169.2
Stentor CoeruleusSteCoe_348012.506567475899953e-46
SGDYAR018C1.0002335610448659e-38KIN3 Nonessential serine/threo
nine protein kinase; possible
role in DNA damage response

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16611747: Wloga D, Camba A, Rogowski K, Manning G, Jerka-Dziadosz M, Gaertig J (2006) Members of the NIMA-related kinase family promote disassembly of cilia by multiple mechanisms. Molecular biology of the cell 17(6):2799-810

Sequences

>TTHERM_00721400(coding)
ATGAGTTCAGTTTCATTGAGCGATTTCAACGTTTAAAAAACTTTAGGAAATGGAGCATTT
TCATGGGTATATAAAGTATAGCGCAAACAAGATGGCTAAGTTTACGCTCTTAAAAAGGTT
AAATTGAGGGAACTCTCTTACAAAGAGAAAGAAAATGCTTTAAACGAAATCAGAATTTTA
GCTTCAATAAACTCTCCTCACATTATCAGATACAAAGATGCATTTTATGATAATGCAAGC
GGATGTCTTTGCATTGTGATGGAATATGCAGAGAACGGCGATTTAATGGCTAAATTGCAA
GATTATAAAAAAAGAAACATGTTTATGGACGAGGCAAAAATTTGGAAATATGCAGCATAG
ATTTTACTGGGTTTAAAATCATTGCATGATCTGAAAATTCTTCATCGTGACTTAAAGTGT
GCAAATATTTTCTTGGGTGCTAATAATAAAGTAAAGTTAGGGGATTTAAATGTCTCTAAA
ATTATGAAGAGAGACCTAGCTTACACTCAAACTGGAACACCTTATTACACATCCCCTGAA
GTTTGGTAAAATCAACCATATGATTCAAAGTGTGATGTTTGGAGCATGGGATGTGTTCTA
TATGAATTGATGGCTCATCATCCTCCATTCGAAGCTAAATCCATGGAGGAACTCTATAAG
AAAGTATGTAAAGGCACCTATTAAAAGCTTCCCAAGTAATATAGCCAAGAAATGAATGAC
TTTATTAATCTTTGCTTGAGAAAAAACCCTAAATAACGTCCTTCTGTGAATTCTCTACTA
GAGTTTTAGGGCCTATTGCCTTACGTTTAAAATATATTGGAGAATGAAGAAGATAAAGAA
AATAAGCAACCCAATATTTAGAAAAATAACTCTTTGAATCTTCTATAGACAATGAAAATG
CCTTATGGAAATCTAAATGCTTTAAAAAACATTTTGCCTAAAGCTTAATTTGAAGATTCA
ATAGATTCCTTTATGGAAGAGTAGTCTTTAGCAAAGAAGTCATCTGGAAATAGACCAATC
TCAGCTGTAAACAATAACGATTTTAAAAACAACATTAACTAAAGACATTCACTTGAGCCT
CAACAAGGAAAGTAATAAAATCAATAGCCTAGCTCAAATATTTAAAGACATGCATAGTCT
CCTCCTTCTCATTCTAATTAATAAATTTTGAGCAGTAGACAAAGAATACAATCTGCTCAT
AACGCAATACTATGCCGTTAAGACTCAAATTCCTCAGTTTAAAATTAACTAAAATCCAAT
AATAATAACGTACCAAACGGAATTAATAATTGCCCTTTACCAAAAAGTCCTGAAATTTTA
GGTAGCAAAAAAATATCTGCCTTATAACGTAATGGAATTGAAATGGTTAAGCCCAGAAAT
TCCATCGAAGAAGGAATACCATTAAGAAACGATAGAGAGAGAGGAAGTGTAAATATTCCT
GTAAATAATAACAGATACCCCTCAGCAGGAAGAAGAAACATTTTATGCTGA


>TTHERM_00721400(protein)
MSSVSLSDFNVQKTLGNGAFSWVYKVQRKQDGQVYALKKVKLRELSYKEKENALNEIRIL
ASINSPHIIRYKDAFYDNASGCLCIVMEYAENGDLMAKLQDYKKRNMFMDEAKIWKYAAQ
ILLGLKSLHDLKILHRDLKCANIFLGANNKVKLGDLNVSKIMKRDLAYTQTGTPYYTSPE
VWQNQPYDSKCDVWSMGCVLYELMAHHPPFEAKSMEELYKKVCKGTYQKLPKQYSQEMND
FINLCLRKNPKQRPSVNSLLEFQGLLPYVQNILENEEDKENKQPNIQKNNSLNLLQTMKM
PYGNLNALKNILPKAQFEDSIDSFMEEQSLAKKSSGNRPISAVNNNDFKNNINQRHSLEP
QQGKQQNQQPSSNIQRHAQSPPSHSNQQILSSRQRIQSAHNAILCRQDSNSSVQNQLKSN
NNNVPNGINNCPLPKSPEILGSKKISALQRNGIEMVKPRNSIEEGIPLRNDRERGSVNIP
VNNNRYPSAGRRNILC


>TTHERM_00721400(gene)
ATGAGTTCAGTTTCATTGAGCGATTTCAACGTTTAAAAAACTTTAGGAAATGGAGCATTT
TCATGGGTATATAAAGTATAGCGCAAACAAGATGGCTAAGTTTACGCTCTTAAAAAGGTT
AAATTGAGGGAACTCTCTTACAAAGAGAAAGAAAATGCTTTAAACGAAATCAGAATTTTA
GCTTCAATAAACTCTCCTCACATTATCAGATACAAAGATGCATTTTATGATAATGCAAGC
GGATGTCTTTGCATTGTGATGGAATATGCAGAGAACGGCGATTTAATGGCTAAATTGCAA
GATTATAAAAAAAGAAACATGTTTATGGACGAGGCAAAAATTTGGAAATATGCAGCATAG
ATTTTACTGGGTTTAAAATCATTGCATGATCTGAAAATTCTTCATCGTGACTTAAAGTGT
GCAAATATTTTCTTGGGTGCTAATAATAAAGTAAAGTTAGGGGATTTAAATGTCTCTAAA
ATTATGAAGAGAGACCTAGCTTACACTCAAACTGGAACACCTTATTACACATCCCCTGAA
GTTTGGTAAAATCAACCATATGATTCAAAGTGTGATGTTTGGAGCATGGGATGTGTTCTA
TATGAATTGATGGCTCATCATCCTCCATTCGAAGCTAAATCCATGGAGGAACTCTATAAG
AAAGTATGTAAAGGCACCTATTAAAAGCTTCCCAAGTAATATAGCCAAGAAATGAATGAC
TTTATTAATCTTTGCTTGAGAAAAAACCCTAAATAACGTCCTTCTGTGAATTCTCTACTA
GAGTTTTAGGGCCTATTGCCTTACGTTTAAAATATATTGGAGAATGAAGAAGATAAAGAA
AATAAGCAACCCAATATTTAGAAAAATAACTCTTTGAATCTTCTATAGACAATGAAAATG
CCTTATGGAAATCTAAATGCTTTAAAAAACATTTTGCCTAAAGCTTAATTTGAAGATTCA
ATAGATTCCTTTATGGAAGAGTAGTCTTTAGCAAAGAAGTCATCTGGAAATAGACCAATC
TCAGCTGTAAACAATAACGATTTTAAAAACAACATTAACTAAAGACATTCACTTGAGCCT
CAACAAGGAAAGTAATAAAATCAATAGCCTAGCTCAAATATTTAAAGACATGCATAGTCT
CCTCCTTCTCATTCTAATTAATAAATTTTGAGCAGTAGACAAAGAATACAATCTGCTCAT
AACGCAATACTATGCCGTTAAGACTCAAATTCCTCAGTTTAAAATTAACTAAAATCCAAT
AATAATAACGTACCAAACGGAATTAATAATTGCCCTTTACCAAAAAGTCCTGAAATTTTA
GGTAGCAAAAAAATATCTGCCTTATAACGTAATGGAATTGAAATGGTTAAGCCCAGAAAT
TCCATCGAAGAAGGAATACCATTAAGAAACGATAGAGAGAGAGGAAGTGTAAATATTCCT
GTAAATAATAACAGATACCCCTCAGCAGGAAGAAGAAACATTTTATGCTGA