Identifiers and Description

Gene Model Identifier

TTHERM_00670880

Standard Name

NRK29 (NIMA-Related Kinase)

Aliases

PreTt01112 | 100.m00173 | 3731.m00083

Description

NIMA-Related Kinase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.5%

TetraMine Data

TTHERM_00670880

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16611747: Wloga D, Camba A, Rogowski K, Manning G, Jerka-Dziadosz M, Gaertig J (2006) Members of the NIMA-related kinase family promote disassembly of cilia by multiple mechanisms. Molecular biology of the cell 17(6):2799-810

Sequences

>TTHERM_00670880(coding)
ATGAATGGCTCAGCTGCTTTGATTTAATATTTAAACATGAAAATGTTCAGTTAAATAAAC
TAAAAGCTCTAACTTTATAAAAACAAGTAGAATATTTAAAAAATATATGAATTCCTAAGA
ACAGCTTCATATTCATAATCATCAATTTTAATTTGA


>TTHERM_00670880(protein)
MNGSAALIQYLNMKMFSQINQKLQLYKNKQNIQKIYEFLRTASYSQSSILI


>TTHERM_00670880(gene)
ATGAATGGCTCAGCTGCTTTGATTTAATATTTAAACATGAAAATGTTCAGTTAAATAAAC
TAAAAGCTCTAACTTTATAAAAACAAGTAGAATATTTAAAAAATATATGAATTCCTAAGA
ACAGCTTCATATTCATAATCATCAATTTTAATTTGA