Identifiers and Description

Gene Model Identifier

TTHERM_00188390

Standard Name

NRK28 (NIMA-Related Kinase )

Aliases

PreTt08589 | 15.m00300 | 3697.m00012

Description

NIMA-Related Kinase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.7%

TetraMine Data

TTHERM_00188390

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06354.19.997093137033517e-262protein kinase domain-containi
ng protein (711 aa)
OxytrichaContig22171.0.0.g215.0000898401533074e-117Protein kinase domain
DictyBaseDDB_G02752412.0007889996237956e-71nek3 on chromosome: 2 position
4983790 to 4987279
WormBaseWBGene000226319.996907204735647e-62locus:nekl-2 status:Confirme
d UniProt:O01775 protein_i
d:CCD64899.1
Stentor CoeruleusSteCoe_348371.2479464629129513e-47
SGDYAR018C1.000159011384939e-43KIN3 Nonessential serine/threo
nine protein kinase; possible
role in DNA damage response

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16611747: Wloga D, Camba A, Rogowski K, Manning G, Jerka-Dziadosz M, Gaertig J (2006) Members of the NIMA-related kinase family promote disassembly of cilia by multiple mechanisms. Molecular biology of the cell 17(6):2799-810

Sequences

>TTHERM_00188390(coding)
ATGAACCCTTATTTAGCCTAGTATTAAGAACTTGAAATTATAGGTCGAGGCAACTTTGGT
TCTGCGACATTAGTTAAAGAAATAGCTACATAGATTCTATTTATTGCTAAAAAAATTATT
TTGGCTGGACTCAAAGAAAGGGAATAGGAATCAGCGAAATAAGAAGCAGAACTTTTAAAA
AGCTTGAAGCATCCAAATATAGTAGCATATAAAGATTCCTTTATGATAGATGGTACTCTT
ATTATTATCATGGAGTATTGTGAAGAGGGTGATATTGCTTTTCACATTAAGCGCAAAAAA
AATAAATAGGAGTATTTTAGCGAGAGAGTAATTCTCAACTGGTTTTTGCAAATAGCTTTC
GCTCTCATATACATCCATGATAAAAAAATATTACATAGAGATATTAAAACTTCCAATATA
TTTGTGACATCAAACGGAACTGTTAAAATTGGAGATTTCGGTATATCAAGAGTACTTGAG
CACACACAAGATTAAGCCTAAACTGTAGTTGGAACACCATACTATATGAGCCCTGAAGTT
TGTGAAAGCAAGCCCTATACTCAAAAATCTGATGTGTGGGCTCTAGGCTGTGTCGTATAC
GAGCTATGCACTTTAAAGCATGCCTTTAACTCAAACAATCTTTTAGGATTAGTATACAAG
ATTGTGAAAGAGTAAGTTGAAGATATTCCTGAAATATATTCAAATGAATTAAAAAATTTA
GTAAAGTAAATGTTTATTAAAGATGATGCATTAAGACCTAATTTGCGCTAAGTTTTAGCA
AGTCCCTTTTTAACTAAAACTATGGAAGAATTTGTGGAAAATTAGGGATAAAACATATAT
TAATCTGAAATTCCAATTCGTAAAACTAATACTCATATGTAAATGCAATAGCAATAGCAA
TATGATGATGGATTAGGTGAAACTGTAAAATCTCAGCAAGCTAATGGTACATAATTTACA
ATAGGTCAAACTATAAATTCAATGTAGCAAACACAACAATAGCGCTATGATTAAACTTTA
GGAGACACTGTTTAATCTGTCAACATTCAAGGTGGAAATTTAACTGCTAAGTAAATGTTG
TAAATCAAAAAGCAATAAGAGAGCGATAAAAAGGCATAAGAGCTGACATAGGCTATAAGA
GAAAATGCATCATTAGTAAATATTGCTAAATAGCGTAAACTAGAATAGCTAAATCATTAA
AACGCAAGAGAAAAGTAAAACATGGCTTAAACTATGTAATAATATTACAGTCAGTAACAA
TAGCCATAATAACAATACTATTCTTCAACCTAAAAATTCTATCCTCAATAAGGATAGTAA
GTACCTATGAATAACTAAAATATGAATATGCTCACTTAGCAAATGGAAATGCTCAGCGTT
TCTTAAAACACAAACTAATTTTATAACTAGCCTTTTGATCATTCCTATCAACCTCAGTAA
ATGTATAACATGCCTATAAATATGAGCCAATAGCAATAATAGAACGAATACAATTATAAC
TAATACAATAACCCTTACAATTAATAATAAGCTATGAATTAGTACTAATAACACAATGAT
CAGACCATAAAAACTGATATTTAAAATGGTAACAAATTCAATGCAACTAATAATGGGTTA
GATGCATATCAAGATGATTTCGAAGAGTATAATAGTGACTAAGAAGATGAAAAAAATAAT
ACCTTCTCATTAACTGCTACATAAAACCGTCTTACTCTAAGAGCTACAGAATCTCAAAGA
GAAGACGTCGTCAACATTTATAAAGATAATCTTAAATTTAAAAACAATGATTTGGAATCT
ATTCATGAATAGTCGGGAGAATATATACCTCAAACACCCCAGAAACAAGGAAAAGGAGAT
GTACCTTATTAAGAAAACAAATCTTTCAACAGTAAAGTAGATAATCTAAGAAAAGAATGC
ATAAATTTATTAACAGAAGAACAATTTAATAAAGTTTATAATTTCATCAAATCTCGCGAT
TACATGAGTAACTAGGACTATTAAGAGTTAAATAAATTAGTTGGAAGAGATATAAAATCT
AAATGCCAAAGGGTAGAAGAGTTAGTTTACTTAGAAAGCATTAGTCATTGA


>TTHERM_00188390(protein)
MNPYLAQYQELEIIGRGNFGSATLVKEIATQILFIAKKIILAGLKEREQESAKQEAELLK
SLKHPNIVAYKDSFMIDGTLIIIMEYCEEGDIAFHIKRKKNKQEYFSERVILNWFLQIAF
ALIYIHDKKILHRDIKTSNIFVTSNGTVKIGDFGISRVLEHTQDQAQTVVGTPYYMSPEV
CESKPYTQKSDVWALGCVVYELCTLKHAFNSNNLLGLVYKIVKEQVEDIPEIYSNELKNL
VKQMFIKDDALRPNLRQVLASPFLTKTMEEFVENQGQNIYQSEIPIRKTNTHMQMQQQQQ
YDDGLGETVKSQQANGTQFTIGQTINSMQQTQQQRYDQTLGDTVQSVNIQGGNLTAKQML
QIKKQQESDKKAQELTQAIRENASLVNIAKQRKLEQLNHQNAREKQNMAQTMQQYYSQQQ
QPQQQYYSSTQKFYPQQGQQVPMNNQNMNMLTQQMEMLSVSQNTNQFYNQPFDHSYQPQQ
MYNMPINMSQQQQQNEYNYNQYNNPYNQQQAMNQYQQHNDQTIKTDIQNGNKFNATNNGL
DAYQDDFEEYNSDQEDEKNNTFSLTATQNRLTLRATESQREDVVNIYKDNLKFKNNDLES
IHEQSGEYIPQTPQKQGKGDVPYQENKSFNSKVDNLRKECINLLTEEQFNKVYNFIKSRD
YMSNQDYQELNKLVGRDIKSKCQRVEELVYLESISH


>TTHERM_00188390(gene)
ATGAACCCTTATTTAGCCTAGTATTAAGAACTTGAAATTATAGGTCGAGGCAACTTTGGT
AAATAAAAATTTGTTTATTAGATTTAGGATAAACCAAGCTTTTAAAAACTAGCTATTACG
TTTATCATTTTAGCTTGATAGATTAGAATCCATATTTAAATATTTATTATATAGGTTCTG
CGACATTAGTTAAAGAAATAGCTACATAGATTCTATTTATTGCTAAAAAAATTATTTTGG
CTGGACTCAAAGAAAGGGAATAGGAATCAGCGAAATAAGAAGTAAAGCCGCTTTAAAAAC
TCTTTATTTATATATTGATTATTCTTGTTATAATTTAGGCAGAACTTTTAAAAAGCTTGA
AGCATCCAAATATAGTAGCATATAAAGATTCCTTTATGATAGATGGTACTCTTATTATTA
TCATGGAGTATTGTGAAGGTAAAAAAAATATTTAAACTCTAAATTAATTTATGAATTTAA
CAATAAAGCTTTCAAATAAATACAAAATAAAAATATTTTTTTATTAATAAATAAATAACT
AATTAAAAGAGGGTGATATTGCTTTTCACATTAAGCGCAAAAAAAATAAATAGGAGTATT
TTAGCGAGAGAGTAATTCTCAACTGGTTTTTGCAAATAGCTTTCGCTCTCATATACATCC
ATGATAAAAAAATATTACATAGAGATATTAAAACTTCCAATATATTTGTGACATCAAACG
GAACTGTTAAAATTGGAGATTTCGGTATATCAAGAGTACTTGAGCACACACAAGATTAAG
CCTAAACTGTAGTTGGAACACCGTAAATATAATTCATAGATAAAAATGAAATTTATTTTT
ATATTAATTAATAGATACTATATGAGGTAGAAAGATTCACAATTTCAATTTTATAACAGC
ATAAATGAAAAAAAGAAATAGAACCATTAAAATATTAATGATTAAGATATGTTTATGCCT
TTAAAATGCATCAGTACTAAACCTAAAATAATAAATAACTCTTATTGCATTATAAATATG
AACAAAAAATTTTTATTTTTTAAAGATAATGAAAATAGATTACTTTAATTTAATTAATTT
TTATCAAATAAAGCCCTGAAGTTTGTGAAAGCAAGCCCTATACTCAAAAATCTGATGTGT
GGGCTCTAGGCTGTGTCGTATACGAGCTATGCACTTTAAAGGTATTTACTAATTAATTAT
TTCTAAAAATAGGCTAAGTAACAATTTATATTTTATATATAGCATGCCTTTAACTCAAAC
AATCTTTTAGGATTAGTATACAAGATTGTGAAAGAGTAAGTTGAAGATATTCCTGAAATA
TATTCAAATGAATTAAAAAATTTAGTAAAGTAAAATTGTTAATTTTTATTGAAAAGATGA
TGATAAAATCTATTAAAACCTTACAAAGTATAAACATTTATTTTATTTATTTATTAAAAG
GTAAATGTTTATTAAAGATGATGCATTAAGACCTAATTTGCGCTAAGTTTTAGCAAGTCC
CTTTTTAACTAAAACTATGGAAGAATTTGTGGAAAATTAGGGATAAAACATATATTAATC
TGAAATTCCAATTCGTAAAACTAATACTCATATGTAAATGCAATAGCAATAGCAATATGA
TGATGGATTAGGTGAAACTGTAAAATCTCAGCAAGCTAATGGTACATAATTTACAATAGG
TCAAACTATAAATTCAATGTAGCAAACACAACAATAGCGCTATGATTAAACTTTAGGAGA
CACTGTTTAATCTGTCAACATTCAAGGTGGAAATTTAACTGCTAAGTAAATGTTGTAAAT
CAAAAAGCAATAAGAGAGCGATAAAAAGGCATAAGAGCTGACATAGGCTATAAGAGAAAA
TGCATCATTAGTAAATATTGCTAAATAGCGTAAACTAGAATAGCTAAATCATTAAAACGC
AAGAGAAAAGTAAAACATGGCTTAAACTATGTAATAATATTACAGTCAGTAACAATAGCC
ATAATAACAATACTATTCTTCAACCTAAAAATTCTATCCTCAATAAGGATAGTAAGTACC
TATGAATAACTAAAATATGAATATGCTCACTTAGCAAATGGAAATGCTCAGCGTTTCTTA
AAACACAAACTAATTTTATAACTAGCCTTTTGATCATTCCTATCAAGTAAATCTAATCAT
TTATTTATTTATTTTTTTTTAGTTTTTATAAAAAGTATTTACTTTTAAAATATTTAAAAA
ATAGCCTCAGTAAATGTATAACATGCCTATAAATATGAGCCAATAGCAATAATAGAACGA
ATACAATTATAACTAATACAATAACCCTTACAATTAATAATAAGCTATGAATTAGTACTA
ATAACACAATGATCAGACCATAAAAACTGATATTTAAAATGGTAACAAATTCAATGCAAC
TAATAATGGGTTAGATGCATATCAAGATGATTTCGAAGAGTATAATAGTGACTAAGAAGA
TGAAAAAAATAATACCTTCTCATTAACTGCTACATAAAACCGTCTTACTCTAAGAGCTAC
AGAATCTCAAAGAGAAGACGTCGTCAACATTTATAAAGATAATCTTAAATTTAAAAACAA
TGATTTGGAATGTAAAATTTTTCTATCTAAATAATATTTTTCTATACAATTAAAATTAAC
TTACACAAAAATAAATAGCTATTCATGAATAGTCGGGAGAATATATACCTCAAACACCCC
AGAAACAAGGAAAAGGAGATGTACCTTATTAAGAAAACAAATCTTTCAACAGTAAAGTAG
ATAATCTAAGAAAAGAATGCATAAATTTATTAACAGAAGAACAATTTAATAAAGTTTATA
ATTTCATCAAATCTCGCGATTACATGAGTAACTAGGTAAGAATCTTTACTTTCGAAATGT
CATGTTTTAATTTTTTTGTTTGTTTTAAAATAGGACTATTAAGAGTTAAATAAATTAGTT
GGAAGAGATATAAAATCTAAATGCCAAAGGGTAGAAGAGTTAGTTTACTTAGAAAGCATT
AGTCATTGA