Identifiers and Description

Gene Model Identifier

TTHERM_00219200

Standard Name

NRK27 (NIMA-Related Kinase )

Aliases

PreTt22348 | 18.m00374 | 3701.m00133

Description

NIMA-Related Kinase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00219200

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06701.19.997093137033517e-262hypothetical protein (1314 aa)
DictyBaseDDB_G02710520.0000000008996637801615584snf2b on chromosome: 1 positio
n 4502537 to 4512340
SGDYGR252W0.0000000020002373268528243GCN5 Acetyltransferase, modifi
es N-terminal lysines on histo
nes H2B and H3; acetylates Rsc
4p, a subunit of the RSC chrom
atin-remodeling complex, alter
ing replication stress toleran
ce; catalytic subunit of the A
DA and SAGA histone acetyltran
sferase complexes; founding me
mber of the Gcn5p-related N-ac
etyltransferase superfamily; m
utant displays reduced transcr
iption elongation in the G-les
s-based run-on (GLRO) assay

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16611747: Wloga D, Camba A, Rogowski K, Manning G, Jerka-Dziadosz M, Gaertig J (2006) Members of the NIMA-related kinase family promote disassembly of cilia by multiple mechanisms. Molecular biology of the cell 17(6):2799-810

Sequences

>TTHERM_00219200(coding)
ATGGACTAAAATCAAAATTAGTTTATAAATAATTAGAATCCTTAGTATTACTAGCAATTC
CATGCTGGAGGCAATGGATAAGAATTATAATAGTAAACAGGGTAGGCTCAATAAGGAACA
TAAAATTATTTTTAGTACATGGAGTAATAGCAGTAATAGCAATATCCTCAAATTCCATAA
TACCCTTAGCAAAACTCAACAGCGCCTTCAAACCCTTAGGTTTAATTGCCATAAAATTAA
TAAATGTATTAGTAGATGTATAATAGAAATTAGTAAATTAATGAAGCGGTTCCTTAGTAT
CAAAGAATATAAGGTGTGCAACCCACATTCTAAGGGATCCCCTAAAATTAAAATCAATAG
ATAGTAAATGCAATTCCATAATATCAAATTGGACAGCAAGTCCAACAACCTATAATGCAT
CATTAATCATAATAGCAAATACCAGTGTAAAACAAGAATTTGCCTCCTGGTCAATAATAA
AATCTATAATAGCAAATTCCAATAAATAAAGGTTAGCCTTAATCTACAATTAATAATATA
AATACCAGCAAACAATAAGCTAAAGCACCAAATCAAACAAATTAAATAGATAAATCTTTG
TTAACAATCTAAAAACAACCTAGTCAGTAGTAAAAAGGTATTTAGTAGCCTTATGTAAAT
TAATTTCAATAATAGAATTCTATTTCTCCTATTCCAAGCTAGATTAACCCTAATAATTTA
CAGGCAGGTAAGACTGCATAATTTTAAAAGCAGCAACCAGGCAGTTCTTAACCTCCTGTA
ATAAACTAAACTCCAGCTCAGTTGTAATAATAGTAAAGTATATAAAAATAAAATGCTCCT
TAAATATAGTAGCAAATGGGATAGAAATAGAACTTAGTTTAGCAGAAGCAATAACCCTAA
TTTAATTAATAAAATCTCCAACAAAAGTAGTAAGTTTAAAATTTAGGGCAACAATAAATG
CAAAACCCAGCTCAGCAGCAGTTTTAAAATAATTTTAAGCAGCTACCTAATTCTAATTCT
ATTGTGGGATAAGCTAATCCTCAAATTTAAACTAACTAATTTTAATCATAATAGCCACCT
CAATAATAGCCAAATCCATAAAAATAGACTATTTAACAACCATAGCATATAAATTAAAAT
AAAATGCAACAATAATAGTAATAATAATAAATAAATAAACCTATTGATTAGAGTTAAAAC
CAACTCGTAAAGCCTTAATAATTTAGTTCACAATAGCCCCTATAGTTATAGTAGTAAATT
CAACAAAATTAAAACCCTCAAAAGCAAATGCAATAACCTAGAACAGGTACTCAGTAATTA
GGTAAACCTTAACAACCAATATAAAAAATGCAAAATCCTGCACTAAATACTTAGTCAAGC
TAGCAATAACAATTCAATATTTAAAATCCATAACTGCAGTAAAGAATATAATCTTAGCAA
TAAACTTAAATAAAATAATAAGTTTAAGGTTCGAAGCCCTAGTTATAGCATCAAAATCAG
CAATTTTAAATGATGGGAAATTAAGCATAAGGAGGATAATAATAAATTTAGTAAAATTAT
CAATAATTTAGTTAAATACCTTAGTCTCAATAGCAATCTTAATCATAATAGCAATAAACC
TAACTTTAATAGTAGGGATAAATGGCAAGTTAAGGTCAGTAGCAACAAGAATAAGTCACT
ACATAAAGATAGAATAGGTTAGACTCTGGTGAAAATTTATTTTAATTTAGCTAGTTGAAT
AAAGCTCGTTAAGATTAAAAACCCTAATAAGGTTCAAACCAAAGAATGGATAATATTAAA
AAAGGATAGTATTTCGACATCAAATAATTTGATTCTGTTCTTGATAATAGAACGATGCCT
AAACTCTTTAATTTGACTCAAACTAAAGCTTATGAAATTAATTCAAACCTTCCTCCTGGT
TATTCTTTAGAACCTTTCTTTATCCACTAACTAAGATTTAACCCTAAGGTATATGGAGAA
GCAGCTAATGATTTTGGAGAGGCACCCTAGAAAAAAATAAAAACAGAAGAAAATCTCTTT
TTGCAATACAGTATTAGTTAGCTTGCTCCAAATGCTCCAATGAAGAGAGAATTAATATAG
CTTATGAATATAAAACCTTCTGTAAATCCTGTTTCAACCTTAATAACTCCAACAACAAAA
AAACCTTCAACATCAAATTAAAATTTAAACTAAGGATCAAGTTTGAACTCTACACCTTAA
AAATCATAAAATGATTTATCAAGGCAGAATTCTAAAATTTAAACCTCAAGCCAGCCCAGC
AGTATTGTATAAAGTACTCAGCAACAATAAATACCTAAAGAAAATAGCTAATAGTAATAA
TAATTATCTTAAAAAACTCCTTAATAAGCAGTTTAAAGCTAAAATCAACAATAGATAAAT
AGCTAGCCATCATAGTTGTAAAAGACATAAGAACAAAGCGTGAATTCTTAAATTTAAAGA
TAAAATCAATAAAACTAAGTTTAAAACTCTTTAAATTAAAACTAAAACCCTTTAAACAAA
AATTTACCTATAAAATAGTAAACACAACAACTTCCTTAACAAGCTAATTAAAATCCTGGT
ATAAATAAAAATATATAGTAACCTGGTTTTTCATAGAATTTATAGAAACCTTAAAATTAA
ATTCCTTAATAATAGATAAAAGTAAAAACTTAATAACCTGGGAATAATGTTTAAAATTAA
GCAGCTCCTCAACCGCCCAACGAAGGATAATAAAATACCTTATAAACAGTAAACAAAACA
CAAGGATAAGTATAAAATGAGATTCAAAATAAATAAATCTAGAACTAAAAGCCTGCTTAA
ACAAATTAAAATGTATAAATAAATTAGTCATAATAACAAAAAGTAAATTTAAATTAGTAG
TCATAAAATTTAAATAATAATATTTAAAATTAAAAAAATTAATAATAAAAGCCTCCATAA
ACATCTCAAAATCTAAATTAATCAAATTTAGTCAATAATTAAGAAAAAAATGTTTCAATT
TCATCTAGTTAATCTTCTTTGAAAATTTAATTACAATTACCTTAGTAGTAATAAAATACA
TAGCAATAGTAGTAATCAAATTAACAATAATAGTAAAATTAATAAATAAATTAAGCTAAT
AGATAAAACTTGCCACAAAATAGCAATACAATTTCCAGATAGTCTTCTTAGTAATCTCTG
TAATAATAAACTACAAATTAAAATAATTTAAACAATAATCAATAGTAATAAGGTTCTTAA
TAAAGTATGCCATAAAATTAAAAAATTCCTTCTTCAAACACATTATAATAGGCAAAAGAA
AAGAATTAATCAAGTGTAATTAAAATAAACTTAAATCTACCACAATAGTCTGAATAACCT
AGTTCTTAAAAGTTACCTGACACTTCTTAAAAATAATTAACATCCTCTAGTTCAAGTAAC
GTGTCTAGAGCTGGCTCATCTTAAAATATTAATATTCCAGGATAGCAGTTGCAAAATAAA
TTATAACAACCTGCTTAATCTTAATAAAATATTGCTCCTCCATTATCGCCTACACCATCG
TAGCCAATAGTAATTAGTACAATTATTGAAAATTTAGATATAGAAGACTCAAATAAATAA
ACTAATGCATAATAGTAGCAATCTAAATAACCTGCAATAGCAGAGAATAATAATAATAAT
GACTAATAAAACTTAAATTAAAAATCTTAGTAAGAATAGAATAAAGGGTAAAGTGTAAGC
GTTCCAAAGAAATCAGAATTACCACCTATTTTATTAAATAATATGTAATCTACATCTAAT
TAACCTTCTAAATAAAATATTCCAGTATTAGCATCACTTCCTCCCATGCTAAGACAACAA
ATGGAGAATTAAAATAAAAATGTTTAAGATCCTTGTAAAAAAGAAAATTAAGGATAAGAA
AGTAATATTCTATCAGAGCCTTTAAAAGAAACGAAAATGGAGATAGAAGAAAACATAGAA
AAATCTAATAAAATTTAAATTAGTTTTAGCAATAATTTAGTAAAAGAGGAAGAGATAAAT
TAATTGAATAAATCTTCTGACCAAATAATCTAAGATTAAAATATAAAGTCTCCTATATTA
CCTCCTTAATAACCAAGCCAGAGACCAAAATCTATTGATTTCCCAAGACCATCTTAACCC
AATTCTTAGCTTTTATTACAGGCTTCTAATTCTTCTAATATCCAAAATAATAAGGAACCA
ATAGTAAAGTCTGAAGAAACTAAAATATTTATAAAAATTCCTGATATTATGACTTCACAA
AGTCAATTAGCTTCTCCAACTAATCCAGAATCTGGTACTGCATTAGCTAGTAATAATATA
TCATTGAAATTTACAAATAAAATAGAAGAAGAAGTTTAAAACGAAGCGAGAACGAAAATA
GAAGAAAATATTAATGCAATGGAAATTGAATAACCTATTGAATAATTAGAATATCAAGAT
TAAAATATAGATGATAATTAGATGCAATTAAACACAGAGACTCCTTACTTTTAAACAGCT
GGATAACAATAAGCAAATTTAAATATAAAAGTAGAGCCCTTTAATGAATTAAACTAAATG
ATAAAATAAGAACACACTCAATCAGATTAAACTTATTTAGATCAAATACAGAAAGGGCCT
TAAGATAATTCCCTAATTATAACACTTCCAAACAACCCCATTCAACAAAAAATAGAAGCT
GATTCTAATTTAATGCCTATGAACCAACTTCCTGCTATGGTTTCATCAGCATCTTTAAAT
AACGATTTTATCAAAGAGAAAAAGAAGAAAATGGAAAAGAAAAATATATCACAAGAAGAT
TAAAAAGCTATGAGTGAAATAATTTAACGTCTTACAAAAAATAAAAATTCAGAACCATTC
AAAAAGTTATCCAGTCTTGCAAAGAATCCTGACTATCTAAAAATTATTAGAGAGCCTATG
GACTTGCAAACTGTGGAAACTAATATAAAGAAAAAATATTATAGTAATATTGACGAAATG
GCAGTTGATGTTAATAAAATATTTGCAAATGCCAAATTATACAACAAAGAAGACACTGAA
ATCTACAAAAAAGCTGTAGAACTAGAAGAATATTTTAAGAAGAAATACTAAAAAAGTCCT
CTGAGCAATGAGATAAATAACCTTTAAAAGAAAGTAGATAAACTTGGTAAAGAATTGAAA
GAGTATCACACTTACGGAGGAAGATTCTTCTACAGAGAAAATAAAAAAATATAAAAGTAA
GCTTTCATGGAGAGATCAATGTCTTTAGATGAAAAGACTTAGCTTGCTAAAAACATAAGA
AAGTTACCTAAGGAATATTGGATTGGTATATGGGAAATAATGACAGATAAGCAGTTTTGT
ATAGCTGATAAATAAAAAATTGAGTTTGATTTAGATACCACTACTCCAAAGTAGTGTAGG
AGGTTAGAAAGATATGTAAAAGCAAAGTTAAATTGTATTTAAAAGGCAAGAGAGAAAAAG
AACAAAAAGCTCGATAAAGCTTAAGGTAAATAGACAAGCGAGTATGTGGACCCTGCAAAA
CTAGAAAAACTAGATACCGATTCTTCTTATATTACAGAATCTGATGACTCTATGAAAGAC
CCAGATGAAGATGGAGGTGATTGA


>TTHERM_00219200(protein)
MDQNQNQFINNQNPQYYQQFHAGGNGQELQQQTGQAQQGTQNYFQYMEQQQQQQYPQIPQ
YPQQNSTAPSNPQVQLPQNQQMYQQMYNRNQQINEAVPQYQRIQGVQPTFQGIPQNQNQQ
IVNAIPQYQIGQQVQQPIMHHQSQQQIPVQNKNLPPGQQQNLQQQIPINKGQPQSTINNI
NTSKQQAKAPNQTNQIDKSLLTIQKQPSQQQKGIQQPYVNQFQQQNSISPIPSQINPNNL
QAGKTAQFQKQQPGSSQPPVINQTPAQLQQQQSIQKQNAPQIQQQMGQKQNLVQQKQQPQ
FNQQNLQQKQQVQNLGQQQMQNPAQQQFQNNFKQLPNSNSIVGQANPQIQTNQFQSQQPP
QQQPNPQKQTIQQPQHINQNKMQQQQQQQQINKPIDQSQNQLVKPQQFSSQQPLQLQQQI
QQNQNPQKQMQQPRTGTQQLGKPQQPIQKMQNPALNTQSSQQQQFNIQNPQLQQRIQSQQ
QTQIKQQVQGSKPQLQHQNQQFQMMGNQAQGGQQQIQQNYQQFSQIPQSQQQSQSQQQQT
QLQQQGQMASQGQQQQEQVTTQRQNRLDSGENLFQFSQLNKARQDQKPQQGSNQRMDNIK
KGQYFDIKQFDSVLDNRTMPKLFNLTQTKAYEINSNLPPGYSLEPFFIHQLRFNPKVYGE
AANDFGEAPQKKIKTEENLFLQYSISQLAPNAPMKRELIQLMNIKPSVNPVSTLITPTTK
KPSTSNQNLNQGSSLNSTPQKSQNDLSRQNSKIQTSSQPSSIVQSTQQQQIPKENSQQQQ
QLSQKTPQQAVQSQNQQQINSQPSQLQKTQEQSVNSQIQRQNQQNQVQNSLNQNQNPLNK
NLPIKQQTQQLPQQANQNPGINKNIQQPGFSQNLQKPQNQIPQQQIKVKTQQPGNNVQNQ
AAPQPPNEGQQNTLQTVNKTQGQVQNEIQNKQIQNQKPAQTNQNVQINQSQQQKVNLNQQ
SQNLNNNIQNQKNQQQKPPQTSQNLNQSNLVNNQEKNVSISSSQSSLKIQLQLPQQQQNT
QQQQQSNQQQQQNQQINQANRQNLPQNSNTISRQSSQQSLQQQTTNQNNLNNNQQQQGSQ
QSMPQNQKIPSSNTLQQAKEKNQSSVIKINLNLPQQSEQPSSQKLPDTSQKQLTSSSSSN
VSRAGSSQNINIPGQQLQNKLQQPAQSQQNIAPPLSPTPSQPIVISTIIENLDIEDSNKQ
TNAQQQQSKQPAIAENNNNNDQQNLNQKSQQEQNKGQSVSVPKKSELPPILLNNMQSTSN
QPSKQNIPVLASLPPMLRQQMENQNKNVQDPCKKENQGQESNILSEPLKETKMEIEENIE
KSNKIQISFSNNLVKEEEINQLNKSSDQIIQDQNIKSPILPPQQPSQRPKSIDFPRPSQP
NSQLLLQASNSSNIQNNKEPIVKSEETKIFIKIPDIMTSQSQLASPTNPESGTALASNNI
SLKFTNKIEEEVQNEARTKIEENINAMEIEQPIEQLEYQDQNIDDNQMQLNTETPYFQTA
GQQQANLNIKVEPFNELNQMIKQEHTQSDQTYLDQIQKGPQDNSLIITLPNNPIQQKIEA
DSNLMPMNQLPAMVSSASLNNDFIKEKKKKMEKKNISQEDQKAMSEIIQRLTKNKNSEPF
KKLSSLAKNPDYLKIIREPMDLQTVETNIKKKYYSNIDEMAVDVNKIFANAKLYNKEDTE
IYKKAVELEEYFKKKYQKSPLSNEINNLQKKVDKLGKELKEYHTYGGRFFYRENKKIQKQ
AFMERSMSLDEKTQLAKNIRKLPKEYWIGIWEIMTDKQFCIADKQKIEFDLDTTTPKQCR
RLERYVKAKLNCIQKAREKKNKKLDKAQGKQTSEYVDPAKLEKLDTDSSYITESDDSMKD
PDEDGGD


>TTHERM_00219200(gene)
GCGGAGAAAAAATATTATTTGTAATAAAGAAATTTTGTTAATAAACAAGCTTCTAAATTT
GAAAGTAGAAAGAGACTCATGGACTAAAATCAAAATTAGTTTATAAATAATTAGAATCCT
TAGTATTACTAGCAATTCCATGCTGGAGGCAATGGATAAGAATTATAATAGTAAACAGGG
TAGGCTCAATAAGGAACATAAAATTATTTTTAGTACATGGAGTAATAGCAGTAATAGCAA
TATCCTCAAATTCCATAATACCCTTAGCAAAACTCAACAGCGCCTTCAAACCCTTAGGTT
TAATTGCCATAAAATTAATAAATGTATTAGTAGATGTATAATAGAAATTAGTAAATTAAT
GAAGCGGTTCCTTAGTATCAAAGAATATAAGGTGTGCAACCCACATTCTAAGGGATCCCC
TAAAATTAAAATCAATAGATAGTAAATGCAATTCCATAATATCAAATTGGACAGCAAGTC
CAACAACCTATAATGCATCATTAATCATAATAGCAAATACCAGTGTAAAACAAGAATTTG
CCTCCTGGTCAATAATAAAATCTATAATAGCAAATTCCAATAAATAAAGGTTAGCCTTAA
TCTACAATTAATAATATAAATACCAGCAAACAATAAGCTAAAGCACCAAATCAAACAAAT
TAAATAGATAAATCTTTGTTAACAATCTAAAAACAACCTAGTCAGTAGTAAAAAGGTATT
TAGTAGCCTTATGTAAATTAATTTCAATAATAGAATTCTATTTCTCCTATTCCAAGCTAG
ATTAACCCTAATAATTTACAGGCAGGTAAGACTGCATAATTTTAAAAGCAGCAACCAGGC
AGTTCTTAACCTCCTGTAATAAACTAAACTCCAGCTCAGTTGTAATAATAGTAAAGTATA
TAAAAATAAAATGCTCCTTAAATATAGTAGCAAATGGGATAGAAATAGAACTTAGTTTAG
CAGAAGCAATAACCCTAATTTAATTAATAAAATCTCCAACAAAAGTAGTAAGTTTAAAAT
TTAGGGCAACAATAAATGCAAAACCCAGCTCAGCAGCAGTTTTAAAATAATTTTAAGCAG
CTACCTAATTCTAATTCTATTGTGGGATAAGCTAATCCTCAAATTTAAACTAACTAATTT
TAATCATAATAGCCACCTCAATAATAGCCAAATCCATAAAAATAGACTATTTAACAACCA
TAGCATATAAATTAAAATAAAATGCAACAATAATAGTAATAATAATAAATAAATAAACCT
ATTGATTAGAGTTAAAACCAACTCGTAAAGCCTTAATAATTTAGTTCACAATAGCCCCTA
TAGTTATAGTAGTAAATTCAACAAAATTAAAACCCTCAAAAGCAAATGCAATAACCTAGA
ACAGGTACTCAGTAATTAGGTAAACCTTAACAACCAATATAAAAAATGCAAAATCCTGCA
CTAAATACTTAGTCAAGCTAGCAATAACAATTCAATATTTAAAATCCATAACTGCAGTAA
AGAATATAATCTTAGCAATAAACTTAAATAAAATAATAAGTTTAAGGTTCGAAGCCCTAG
TTATAGCATCAAAATCAGCAATTTTAAATGATGGGAAATTAAGCATAAGGAGGATAATAA
TAAATTTAGTAAAATTATCAATAATTTAGTTAAATACCTTAGTCTCAATAGCAATCTTAA
TCATAATAGCAATAAACCTAACTTTAATAGTAGGGATAAATGGCAAGTTAAGGTCAGTAG
CAACAAGAATAAGTCACTACATAAAGATAGAATAGGTTAGACTCTGGTGAAAATTTATTT
TAATTTAGCTAGTTGAATAAAGCTCGTTAAGATTAAAAACCCTAATAAGGTTCAAACCAA
AGAATGGATAATATTAAAAAAGGATAGTATTTCGACATCAAATAATTTGATTCTGTTCTT
GATAATAGAACGATGCCTAAACTCTTTAATTTGACTCAAACTAAAGCTTATGAAATTAAT
TCAAACCTTCCTCCTGGTTATTCTTTAGAACCTTTCTTTATCCACTAACTAAGATTTAAC
CCTAAGGTATATGGAGAAGCAGCTAATGATTTTGGAGAGGCACCCTAGAAAAAAATAAAA
ACAGAAGAAAATCTCTTTTTGGTAAAACATTTTTATTTTGATCTATTATTTTTTATAAAT
ATTAATCTTTTAACAACTAAATAAATAAATAATACATAAAGCAATACAGTATTAGTTAGC
TTGCTCCAAATGCTCCAATGAAGAGAGAATTAATATAGCTTATGAATATAAAACCTTCTG
TAAATCCTGTTTCAACCTTAATAACTCCAACAACAAAAAAACCTTCAACATCAAATTAAA
ATTTAAACTAAGGATCAAGTTTGAACTCTACACCTTAAAAATCATAAAATGATTTATCAA
GGCAGAATTCTAAAATTTAAACCTCAAGCCAGCCCAGCAGTATTGTATAAAGTACTCAGC
AACAATAAATACCTAAAGAAAATAGCTAATAGTAATAATAATTATCTTAAAAAACTCCTT
AATAAGCAGTTTAAAGCTAAAATCAACAATAGATAAATAGCTAGCCATCATAGTTGTAAA
AGACATAAGAACAAAGCGTGAATTCTTAAATTTAAAGATAAAATCAATAAAACTAAGTTT
AAAACTCTTTAAATTAAAACTAAAACCCTTTAAACAAAAATTTACCTATAAAATAGTAAA
CACAACAACTTCCTTAACAAGCTAATTAAAATCCTGGTATAAATAAAAATATATAGTAAC
CTGGTTTTTCATAGAATTTATAGAAACCTTAAAATTAAATTCCTTAATAATAGATAAAAG
TAAAAACTTAATAACCTGGGAATAATGTTTAAAATTAAGCAGCTCCTCAACCGCCCAACG
AAGGATAATAAAATACCTTATAAACAGTAAACAAAACACAAGGATAAGTATAAAATGAGA
TTCAAAATAAATAAATCTAGAACTAAAAGCCTGCTTAAACAAATTAAAATGTATAAATAA
ATTAGTCATAATAACAAAAAGTAAATTTAAATTAGTAGTCATAAAATTTAAATAATAATA
TTTAAAATTAAAAAAATTAATAATAAAAGCCTCCATAAACATCTCAAAATCTAAATTAAT
CAAATTTAGTCAATAATTAAGAAAAAAATGTTTCAATTTCATCTAGTTAATCTTCTTTGA
AAATTTAATTACAATTACCTTAGTAGTAATAAAATACATAGCAATAGTAGTAATCAAATT
AACAATAATAGTAAAATTAATAAATAAATTAAGCTAATAGATAAAACTTGCCACAAAATA
GCAATACAATTTCCAGATAGTCTTCTTAGTAATCTCTGTAATAATAAACTACAAATTAAA
ATAATTTAAACAATAATCAATAGTAATAAGGTTCTTAATAAAGTATGCCATAAAATTAAA
AAATTCCTTCTTCAAACACATTATAATAGGCAAAAGAAAAGAATTAATCAAGTGTAATTA
AAATAAACTTAAATCTACCACAATAGTCTGAATAACCTAGTTCTTAAAAGTTACCTGACA
CTTCTTAAAAATAATTAACATCCTCTAGTTCAAGTAACGTGTCTAGAGCTGGCTCATCTT
AAAATATTAATATTCCAGGATAGCAGTTGCAAAATAAATTATAACAACCTGCTTAATCTT
AATAAAATATTGCTCCTCCATTATCGCCTACACCATCGTAGCCAATAGTAATTAGTACAA
TTATTGAAAATTTAGATATAGAAGACTCAAATAAATAAACTAATGCATAATAGTAGCAAT
CTAAATAACCTGCAATAGCAGAGAATAATAATAATAATGACTAATAAAACTTAAATTAAA
AATCTTAGTAAGAATAGAATAAAGGGTAAAGTGTAAGCGTTCCAAAGAAATCAGAATTAC
CACCTATTTTATTAAATAATATGTAATCTACATCTAATTAACCTTCTAAATAAAATATTC
CAGTATTAGCATCACTTCCTCCCATGCTAAGACAACAAATGGAGAATTAAAATAAAAATG
TTTAAGATCCTTGTAAAAAAGAAAATTAAGGATAAGAAAGTAATATTCTATCAGAGCCTT
TAAAAGAAACGAAAATGGAGATAGAAGAAAACATAGAAAAATCTAATAAAATTTAAATTA
GTTTTAGCAATAATTTAGTAAAAGAGGAAGAGATAAATTAATTGAATAAATCTTCTGACC
AAATAATCTAAGATTAAAATATAAAGTCTCCTATATTACCTCCTTAATAACCAAGCCAGA
GACCAAAATCTATTGATTTCCCAAGACCATCTTAACCCAATTCTTAGCTTTTATTACAGG
CTTCTAATTCTTCTAATATCCAAAATAATAAGGAACCAATAGTAAAGTCTGAAGAAACTA
AAATATTTATAAAAATTCCTGATATTATGACTTCACAAAGTCAATTAGCTTCTCCAACTA
ATCCAGAATCTGGTACTGCATTAGCTAGTAATAATATATCATTGAAATTTACAAATAAAA
TAGAAGAAGAAGTTTAAAACGAAGCGAGAACGAAAATAGAAGAAAATATTAATGCAATGG
AAATTGAATAACCTATTGAATAATTAGAATATCAAGATTAAAATATAGATGATAATTAGA
TGCAATTAAACACAGAGACTCCTTACTTTTAAACAGCTGGATAACAATAAGCAAATTTAA
ATATAAAAGTAGAGCCCTTTAATGAATTAAACTAAATGATAAAATAAGAACACACTCAAT
CAGATTAAACTTATTTAGATCAAATACAGAAAGGGCCTTAAGATAATTCCCTAATTATAA
CACTTCCAAACAACCCCATTCAACAAAAAATAGAAGCTGATTCTAATTTAATGCCTATGA
ACCAACTTCCTGCTATGGTTTCATCAGCATCTTTAAATAACGATTTTATCAAAGAGAAAA
AGAAGAAAATGGAAAAGAAAAATATATCACAAGAAGATTAAAAAGCTATGAGTGAAATAA
TTTAACGTCTTACAAAAAATAAAAATTCAGAACCATTCAAAAAGTTATCCAGTCTTGCAA
AGAATCCTGACTATCTAAAAATTATTAGAGAGCCTATGGACTTGCAAACTGTGGAAACTA
ATATAAAGAAAAAATATTATAGTAATATTGACGAAATGGCAGTTGATGTTAATAAAATAT
TTGCAAATGCCAAATTATACAACAAAGAAGACACTGAAATCTACAAAAAAGCTGTAGAAC
TAGAAGAATATTTTAAGAAGAAATACTAAAAAAGTCCTCTGAGCAATGAGATAAATAACC
TTTAAAAGAAAGTAGATAAACTTGGTAAAGAATTGAAAGAGTATCACACTTACGGAGGAA
GATTCTTCTACAGAGAAAATAAAAAAATATAAAAGTAAGCTTTCATGGAGAGATCAATGT
CTTTAGATGAAAAGACTTAGCTTGCTAAAAACATAAGAAAGTTACCTAAGGAATATTGGA
TTGGTATATGGGAAATAATGACAGATAAGCAGTTTTGTATAGCTGATAAATAAAAAATTG
AGTTTGATTTAGATACCACTACTCCAAAGTAGTGTAGGAGGTTAGAAAGATATGTAAAAG
CAAAGTTAAATTGTATTTAAAAGGCAAGAGAGAAAAAGAACAAAAAGCTCGATAAAGTAA
ATATTTTTTAACTATTTGTCATCTTTATTTTGTATTTATTTCTTTAATTATTTAAATCAA
AATAGGCTTAAGGTAAATAGACAAGCGAGTATGTGGACCCTGCAAAACTAGAAAAACTAG
ATACCGATTCTTCTTATATTACAGGTATTTTAGGAAATTAAGCTTTTTCTATTTTCTTAA
AAATTCTATTTTTTTAAACAGAATCTGATGACTCTATGAAAGACCCAGATGAAGATGGAG
GTGATTGA