Identifiers and Description

Gene Model Identifier

TTHERM_01000150

Standard Name

NRK26 (NIMA-Related Kinase )

Aliases

PreTt15734 | 190.m00044 | 3820.m00269

Description

NIMA-Related Kinase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_01000150

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19756.19.997093137033517e-262protein kinase domain-containi
ng protein (791 aa)
OxytrichaContig16615.0.g13.998941839720987e-159Protein kinase domain
DictyBaseDDB_G02752417.002855521298715e-86nek3 on chromosome: 2 position
4983790 to 4987279
Stentor CoeruleusSteCoe_44548.854771883513433e-70
WormBaseWBGene000226319.001992589090134e-64locus:nekl-2 status:Confirme
d UniProt:O01775 protein_i
d:CCD64899.1
SGDYJL164C4.000437458487249e-40TPK1 cAMP-dependent protein ki
nase catalytic subunit; promot
es vegetative growth in respon
se to nutrients via the Ras-cA
MP signaling pathway; inhibite
d by regulatory subunit Bcy1p
in the absence of cAMP; partia
lly redundant with Tpk2p and T
pk3p

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01000150(coding)
TCAAATCAATCAAATTTGTCAAAATAAATTAAAAAATTAAGATAATAAGTAAATATGGAA
AAGTATACTAAAATCAAAGTTGTTGGTAAAGGTAGTTTTGGTTATGCGGTCCTTGTTTAA
TCAAACACTGAAAATAACAAAAAATACTATGTGATTAAGATTATTGATATATCAAAAATG
GATAGAAAACAAAGAGAAGAAGCATTGAATGAAGTTCATGTTTTGAAAGCTATGAAACAT
CCTTATATTATTACTTATAGAGAATCTTTTATAGAAAAAAGGTGTTTGTGTATAATTATG
GAATATGCTTAAGGGGGAGATTTGTATACGAAAATAGCAAAACAAAAAGAAAAAGGACAG
CTCTTTAGCGAAAAATAAATTATAGATTGGTTTGTTCAAATGGCTTTGGCAATAAAACAC
GTTCATGATCGAAAAATTCTACACAGAGATTTAAAGACGCAAAACATATTTTTGAATGCA
AAGGGAGATATAAAAATAGGTGATTTTGGTATTGCTAGAGTTCTTTAGCATACATATGAC
TGCGCAAAAACAGCTATAGGTACTCCCTACTATTTAAGCCCAGAAATTTGTTAAGAAAAA
CCCTACAATCAAAAATCAGACATTTGGTCTCTTGGATGTATCTTATATGAAATGACTACT
TTAAATCATGCATTTGATGCTAACAGTATGAAAGGTTTAGTTTTGAAAATTTTAAGAGGA
ACATATCCACCAATTCCAGAGTAATACTCTTAAGATTTAAGAGATCTAATTTCAGAAATG
CTTATCAAAGATCCCACATAAAGGCCATCTATTCGCAAAATTTTGGAAAAAGATTTTTTA
AAGAATCGTATCAGTGAATTATTCTCAAATACATTACAAAGAAATGATCCTTAGTCAGGA
GCTCAAATTTTGGAAATCAGAAATCCTGCAGATTAAATTTCTCAATAAAACGACTAGTAA
GAGTTAGAAAAATAAAAAGAACAACAAATAAATGAGAATTTTAAAAAGCTTGACTAAAAT
CCAAAAGTTGAATTACCTTAGTAAAAACCTAGTTCTAGCTTACTCAAAAAAGATGGTCAA
ACTGACTCATCATCACAGTTTGCAAAACCAATTCCTATGTAATAATAACCAAGCTTGCAA
TCGTTTTAATAATAATAACAATCATAAATTCAACTATAACAGTAATAATAATAATCACAA
ATTAATTCAGGGTTGTTCTAAGCAGGGTCATAATTCAGCTCTAAAAACCCTTCTTAACAG
TCATCATAGTCTTAATTAACCTTGCTTCAAAAAAGCTAACTTTAGTAACAATAATAGCAG
TAATAAAAATAGTAATAACAATAATAATCAATTACAAAGAGTCCTATGGATTCTATATAA
AAGTCTCAAATACTTCCATAATAATCTTATTTTATAAATAAAAGTCCTTTGAGAGGCTAA
TATTCATCTTAATAATAAAATAATAGCATAAACAATAGCAACAATAATAGTTTTAACAAA
GAAAATTTTAATAGAGGATCTTCTCCTTACCGTTAATTTGGAATGAATAATTAAGTGTAA
AGCTAAGATAATACAAGCAACAGTATAAACACAAGCAATAGCTATTTAACTATGCTGAAT
AAAATTAACAGCTAATAGCCTTCATAAATGTAATCAAAAGAGAATAGTATTATTTCTAAG
CCAGGCAGCTAAAATTTAATTAATGAAAACTTAAAATACATCACTGATAAATATAAAGAA
GGATAGAATTAAACTCCATCCTCAAGTATTCCAAACAGCAATAATTCAAGTATTATAAAA
GAAGCTCTTAAAGTGAATAATAATGTTACAAACATTTCTGTTAATAATGTAATTACATAA
TCAGATAATACAAGTAGCTAGAATATTTTAAATAAAATTGAGAAAAAATCATTGCTTCCT
TAATCTGGTAGCTAACTTGCTATTAAACCAACACTTTCTCCTTTTGGCACCAATAATAAT
AGTGCTGTTAGCAGCAATTAGATTTCTAAAAAACCTTCTTAAGTCAATATTGCTGCCCCT
AATATGATTAATGGAAATTAAAGAGGAGATGACGATGAAACTTTAGAAGAATAAGGATAC
GGATATTTACTATAGTCTATTTAAGATTGTTTAGCTAACAAACCATCAAATTCAAAGTAA
AAAGATGAGGAGGAAGAAAATTTCGGAGATTAATAATTCTAAATTTTCCCAAAGTTCTTG
CAAATTGATGGAAAACCATTTATTGTACCTGGTATATCAAATAAAGATACAACTGGCTCT
AAAATTGAGGCACTAAGGTACTACTTAGAAAAAGAAATAGGAGTTGATTAATTTATGGAA
GTATATAGACTTATAATAGAAAATTAAAGTAATGACGATAATAAGTAGATAACTAGGTTG
ATAGGTGAGAAAAAAGTTAAATTCTTACCATTAATTTATTAACTAATAGTTTGTGAAGAA
AGCTATTATGGAAATTGA


>TTHERM_01000150(protein)
SNQSNLSKQIKKLRQQVNMEKYTKIKVVGKGSFGYAVLVQSNTENNKKYYVIKIIDISKM
DRKQREEALNEVHVLKAMKHPYIITYRESFIEKRCLCIIMEYAQGGDLYTKIAKQKEKGQ
LFSEKQIIDWFVQMALAIKHVHDRKILHRDLKTQNIFLNAKGDIKIGDFGIARVLQHTYD
CAKTAIGTPYYLSPEICQEKPYNQKSDIWSLGCILYEMTTLNHAFDANSMKGLVLKILRG
TYPPIPEQYSQDLRDLISEMLIKDPTQRPSIRKILEKDFLKNRISELFSNTLQRNDPQSG
AQILEIRNPADQISQQNDQQELEKQKEQQINENFKKLDQNPKVELPQQKPSSSLLKKDGQ
TDSSSQFAKPIPMQQQPSLQSFQQQQQSQIQLQQQQQQSQINSGLFQAGSQFSSKNPSQQ
SSQSQLTLLQKSQLQQQQQQQQKQQQQQQSITKSPMDSIQKSQILPQQSYFINKSPLRGQ
YSSQQQNNSINNSNNNSFNKENFNRGSSPYRQFGMNNQVQSQDNTSNSINTSNSYLTMLN
KINSQQPSQMQSKENSIISKPGSQNLINENLKYITDKYKEGQNQTPSSSIPNSNNSSIIK
EALKVNNNVTNISVNNVITQSDNTSSQNILNKIEKKSLLPQSGSQLAIKPTLSPFGTNNN
SAVSSNQISKKPSQVNIAAPNMINGNQRGDDDETLEEQGYGYLLQSIQDCLANKPSNSKQ
KDEEEENFGDQQFQIFPKFLQIDGKPFIVPGISNKDTTGSKIEALRYYLEKEIGVDQFME
VYRLIIENQSNDDNKQITRLIGEKKVKFLPLIYQLIVCEESYYGN


>TTHERM_01000150(gene)
TTCAAATCAATCAAATTTGTCAAAATAAATTAAAAAATTAAGATAATAAGTAAATATGGA
AAAGTATACTAAAATCAAAGTTGTTGGTAAAGGTAACCACTTCTTAATCACTCATATTAT
CAAATCTATAAACCCTTCAAAAATAATTAATTATTAGGTAGTTTTGGTTATGCGGTCCTT
GTTTAATCAAACACTGAAAATAACAAAAAATACTATGTGATTAAGGTATTATTGATATTA
CTCATAACAATATTTGAATGTTCTGATATACATTAATATTAAATAGATTATTGATATATC
AAAAATGGATAGAAAACAAAGAGAAGAAGCATTGAATGAAGTTCATGTTTTGAAAGCTAT
GAAACATCCTTATATTATTACTTATAGAGAATCTTTTATAGAAAAAAGGTATATATATAT
ATTTAATAGTTTTGCTAATTATTATCTAACTTAATATAACAAAGGTGTTTGTGTATAATT
ATGGAATATGCTTAAGGGGGAGATTTGTATACGAAAATAGCAAAACAAAAAGAAAAAGGA
CAGCTCTTTAGCGAAAAATAAATTATAGATTGGTTTGTTCAAATGGCTTTGGCAATAAAA
CACGTTCATGATCGAAAAATTCTACACAGAGATTTAAAGACGCAAAACATATTTTTGAAT
GCAAAGGGAGATATAAAAATAGGTATGCTGTTAATGAACTTTAAATAAAATATTTTTTTG
TTTTCTCACGCATGCTTGCTCTTTAAAAAAACTTTAAATCAATTAAAAGCTAGAGTTTTT
TTAAAACAACACTAATTAAAATAAATATTTAATTTAAGGTTTGAATTCAAATATAAAAAC
TAATTTATTTCTTCAAACAACTAATTTTTTTTCTAACGTAAAATTTTAAAGGTGATTTTG
GTATTGCTAGAGTTCTTTAGCATACATATGACTGCGCAAAAACAGCTATAGGTACTCCCT
ACTATTTAAGCCCAGAAATTTGTTAAGAAAAACCCTACAATCAAAAATCAGACATTTGGT
CTCTTGGATGTATCTTATATGAAATGACTACTTTAAATCATGCATTTGATGCTAACAGTA
TAATAATATTTTAATTTAAAATAGCATAAAATATTTTTCAACCAATAACATTAGGTATGA
AAGGTTTAGTTTTGAAAATTTTAAGAGGAACATATCCACCAATTCCAGAGTAATACTCTT
AAGATTTAAGAGATCTAATTTCAGAAATGCTTATCAAAGATCCCACATAAAGGCCATCTA
TTCGCAAAATTTTGGAAAAAGATTTTTTAAAGGTAAATTATTTGGATAAACAAACAAAGA
AGTGATTATTAAAAATTATTAAATTTAGAATCGTATCAGTGAATTATTCTCAAATACATT
ACAAAGAAATGATCCTTAGTCAGGAGCTCAAATTTTGGAAATCAGAAATCCTGCAGATTA
AATTTCTCAATAAAACGACTAGTAAGAGTTAGAAAAATAAAAGTAACTAATAAATAAATT
AAACATTTTTATTAAATTATTAAAATTTTTTATTGAAAAATTAATTTAAAAAAAACAGAG
AACAACAAATAAATGAGAATTTTAAAAAGCTTGACTAAAATCCAAAAGTTGAATTACCTT
AGTAAAAACCTAGTTCTAGCTTACTCAAAAAAGATGGTCAAACTGACTCATCATCACAGT
TTGCAAAACCAATTCCTATGTAATAATAACCAAGCTTGCAATCGTTTTAATAATAATAAC
AATCATAAATTCAACTATAACAGTAATAATAATAATCACAAATTAATTCAGGGTTGTTCT
AAGCAGGGTCATAATTCAGCTCTAAAAACCCTTCTTAACAGTCATCATAGTCTTAATTAA
CCTTGCTTCAAAAAAGCTAACTTTAGTAACAATAATAGCAGTAATAAAAATAGTAATAAC
AATAATAATCAATTACAAAGAGTCCTATGGATTCTATATAAAAGTCTCAAATACTTCCAT
AATAATCTTATTTTATAAATAAAAGTCCTTTGAGAGGCTAATATTCATCTTAATAATAAA
ATAATAGCATAAACAATAGCAACAATAATAGTTTTAACAAAGAAAATTTTAATAGAGGAT
CTTCTCCTTACCGTTAATTTGGAATGAATAATTAAGTGTAAAGCTAAGATAATACAAGCA
ACAGTATAAACACAAGCAATAGCTATTTAACTATGCTGAATAAAATTAACAGCTAATAGC
CTTCATAAATGTAATCAAAAGAGAATAGTATTATTTCTAAGCCAGGCAGCTAAAATTTAA
TTAATGAAAACTTAAAATACATCACTGATAAATATAAAGAAGGATAGAATTAAACTCCAT
CCTCAAGTATTCCAAACAGCAATAATTCAAGTATTATAAAAGAAGCTCTTAAAGTGAATA
ATAATGTTACAAACATTTCTGTTAATAATGTAATTACATAATCAGATAATACAAGTAGCT
AGAATATTTTAAATAAAATTGAGAAAAAATCATTGCTTCCTTAATCTGGTAGCTAACTTG
CTATTAAACCAACACTTTCTCCTTTTGGCACCAATAATAATAGTGCTGTTAGCAGCAATT
AGATTTCTAAAAAACCTTCTTAAGTCAATATTGCTGCCCCTAATATGATTAATGGAAATT
AAAGAGGAGATGACGATGAAAGTAATTATTTGATTAAATAAATTAATAATAATTTATTTT
TTTTTTAATTTTAAAATAATATTTTATTCAAAATAGCTTTAGAAGAATAAGGATACGGAT
ATTTACTATAGTCTATTTAAGATTGTTTAGCTAACAAACCATCAAATTCAAAGTAAAAAG
ATGAGGAGGAAGAAAATTTCGGAGATTAATAATTCTAAATTTTCCCAAAGTAATAAATAA
TATTTTATTGTTAATTTGTTAATAAATATTAAATATTTTTAATTTTAGGTTCTTGCAAAT
TGATGGAAAACCATTTATTGTACCTGGTATATCAAATAAAGATACAACTGGCTCTAAAAT
TGAGGCACTAAGGTACTACTTAGAAAAAGAAATAGGAGTTGATTAATTTATGGAAGTATA
TAGACTTATAATAGAAGTAATTTAATTTTTTTGAGTTTTAATTAATTTAGAAACTTTATA
AAATAGAATTAAAGTAATGACGATAATAAGTAGATAACTAGGTTGATAGGTGAGAAAAAA
GTTAAATTCTTACCATTAATTTATTAACTAATAGTTTGTGAAGAAAGCTATTATGGAAAT
TGAAAAAGAATAAAAATTTACTAAGACAGTTAGTACTATCTATCTAAATAAATAAATAAT
TAACTAACTAACAAATAAACAACTAATTAATTAATTAATAAAATAATATATTACTAATTC
AATATTTTTTGGATAGGGTTAAATAATTATGCAATAAAATTTCTTATAAATATAATTAGC
TGATTAATTAATTTATATAAATAATTCTTACTTAATTCTATTTTATTATGTAGAGATTCA
TTATGTAATTATATATAATTAATTATAAATTTTAAAGAGTTTCATTAAATTATTATTTTG
TTTATTTTTTGTTTTTAAATTTAATATTT