Identifiers and Description

Gene Model Identifier

TTHERM_00415780

Standard Name

NRK24 (NIMA-Related Kinase )

Aliases

PreTt13547 | 45.m00192 | 3833.m00745

Description

NIMA-Related Kinase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase
  • ( TIGR01387 ) heavy metal response regulator
  • ( PF00072 ) response regulator receiver domain
  • ( TIGR01818 ) nitrogen regulation protein NR(I)
  • ( TIGR02875 ) sporulation transcription factor Spo0A
  • ( PF00610 ) Domain found in Dishevelled, Egl-10,
  • ( TIGR02154 ) phosphate regulon transcriptional regulatory protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00415780

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06005.19.997093137033517e-262protein kinase domain-containi
ng protein (831 aa)
OxytrichaContig8286.0.g257.996706633065278e-159Protein kinase domain
WormBaseWBGene000214613.000235161122315e-61locus:nekl-1 status:Partiall
y_confirmed UniProt:Q6AW07
protein_id:CCD69902.1
Stentor CoeruleusSteCoe_217816.375869581278994e-59
DictyBaseDDB_G02892779.001131581050935e-57nek4 on chromosome: 5 position
2561379 to 2563106
SGDYDR523C6.000354955737408e-39SPS1 Putative protein serine/t
hreonine kinase expressed at t
he end of meiosis and localize
d to the prospore membrane, re
quired for correct localizatio
n of enzymes involved in spore
wall synthesis

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16611747: Wloga D, Camba A, Rogowski K, Manning G, Jerka-Dziadosz M, Gaertig J (2006) Members of the NIMA-related kinase family promote disassembly of cilia by multiple mechanisms. Molecular biology of the cell 17(6):2799-810

Sequences

>TTHERM_00415780(coding)
ATGGCGGATAGATCATATTAAAGTATTCATGTTTTAGTCGCAGAGGATGATAATTTCCAA
AGATTAGCTCTTATAGATATTTTGACCCTTTGCGATTACCAAGTTACTGCTGTAGAAAAC
GGAAGATTAGCTAGGGATGAACTCTTAAAAGCAGATTCAAATATTGATATTGTTCTTTTA
GATCTATACATGCCAGAGATGGATGGTATTGAGTTATTATTATTAATGTAAGAACATGAA
CATTTAAAAAGAATTCCTGTAATTATGATGAGTTTCGATAATGAATAAGAAAGAGTTGCC
TATTGTATTGCAAATGGAGCTAAAGATTATCTTGTTAAACCTCTTAGAATTTAAAACGTT
AAAGGTTTAGCAAAATATGTGGAATATAATCCAAACAATACCACAGTAGGAAATGGAGGA
GTTGGTTTATAGTCTTATAAAGTAATTAGAATGATTGGTTAAGGCGCAGGAGGAAGTGTA
GAGTTAGTTTAAAAAAGAAGCGATGGATAACTTTTTGCTCTCAAAACTATTAGTATGAAA
TTCATGGATGACTAGTAAAAAAAAATGGCATAACAGGAAATCACCTTGTTAAAAGTGCTT
GTTGCTCCTTCTATAATTCGTTATTATGAATCTTTTGTGGAAAATGATTCGATTCACATT
ATCATGGAATACGCTAAAGAAGGTGCCTTAAGCGATAAAATTACAGAACATAAATAAAAA
GGAATACCTATAGATGAAGAAACAGTTTTATATTTCACAGCATAGATTATTATTTCAGTG
CTTTTTATGCACTCTAAAAACATTTTGCACAGAGATATTAAAACTTAAAATCTCTTTTTG
ACCAAAGAAAATATAGTTAAGTTAGGAGATTTTGGTATCTCTAAAGAATTAGGTACAAAT
GCAAACGCAAAGACATTAGTTGGTACACCTTATTTCATGTCTCCTGAAGTATGCAGTGGT
GAAAATTATGGATAAAAAGCAGATATTTGGGCTATAGGGTGCACTTTGTACGAAATGGTC
ATGCTGAAAAGACCTTTTGATAACGATAACTTGAATATTCTTTTCAATAAAATTAGATTT
GAAGCTCCTCCTCCTTTACATGAAAATACTAGTACTGAAATACGTATGCTTATAACATTC
ATGCTTTAAAAGGACCCAGTAAAAAGACCTTCTGTTTGGGATTTGGCTAAAATTCCTATC
ATATCTAAAAATATCAGAAAATATTATGAAGAAGAAGCTCAAGATGATCCATTTTTAAAG
GAATATATCTTTTCTGGACCTAAAAATCACCCAAATATAAATAAAAATGTGCCAAAAGAC
GAAAAGAAAAATACAAGCGATAATACTTCAAAAACTTAAGATTAGTCTTAAAACACAAAT
GAAGAGATGTTTAAAGCTCTTAGTTCCGCTTTGTCTCCTTATGACTAGAAAATTAGCATG
TTTAAGGTTGAAAGAAACGTCATAAATGGAAAGTAGTTATTTTAATGGATTTAGCAATAC
TATACAAATTACAATACTTCTCAGGTAGTTGAAATGTTGAATGAGTTAGTTGAGAAAAAA
TATCTTCACCACATTGCTGGTCCTTTGCATCAATCTGATCCAAATTCTTTATATAGATTC
TAATTTGATATGCCAGGAATTGCAGCTAATCTGACAAGAATTTGGAATAAGACTGCTAGA
CCTGCTCTTTAATGTCTTTAGGGAATTGTAGAAACTGCAAATGAAGTATTAACTGAAGTT
ACAGATAAGCTGGAAGGAAAGGTTTTTGATGATAAGCTATATCAAAATAAAAAATATATC
AAATTCTTAGAATTGGTTTGTGAGCTGTAAAAAATTTATTTGTAAGATACTAATGAACAA
GAGAGAAAGTGCATTTTTATCAATTTACTCTAAATTATGTATTTCCATAAATTCATGAAG
CAAAGATACATCAGAATGAGGAACGAAAAGAAAGAAAAAGTCACTACTCTTTTTGAGACT
TTAGCATCATTTTTGCCTTTCTTTAGCAAAAGTTAAGATGAATTTTACTATACTATTGGT
AACCTTTAATTCACATTAGATGACATTAAGCATGGTATAATAAGAGGTAATAAGACTCAA
AAATTAAGCTCATTTAAGCCATTTGCAGACAACGATAGTAGGAAATAATTTGTTCTAACT
CCAGATTTAAGAATTTTGATGCTTTTTAAAGAAGAAAATGTCATTCCAACTGAGTTGAAA
TATATAAAATTAGAAACTATGGAATAGTAGTTAAATGAAATTTGCAATAAATTTTTGAGC
ACATACGTGTACATAGATAATATAGAAAATGATCTAACTATGCATAAGATATTCTAAATA
TATCAAAGCGATTTCGGCCCAGAACCATAAGATGCAATAGTGTGGGCTTCAAACTACACT
AAAAATCTAGGTAGAGTAGACGATTTAGTTTAAAATATAAAATCAGGAGATATATTTGTA
TAGTATTAAGAAAAATTTGAATCCTGA


>TTHERM_00415780(protein)
MADRSYQSIHVLVAEDDNFQRLALIDILTLCDYQVTAVENGRLARDELLKADSNIDIVLL
DLYMPEMDGIELLLLMQEHEHLKRIPVIMMSFDNEQERVAYCIANGAKDYLVKPLRIQNV
KGLAKYVEYNPNNTTVGNGGVGLQSYKVIRMIGQGAGGSVELVQKRSDGQLFALKTISMK
FMDDQQKKMAQQEITLLKVLVAPSIIRYYESFVENDSIHIIMEYAKEGALSDKITEHKQK
GIPIDEETVLYFTAQIIISVLFMHSKNILHRDIKTQNLFLTKENIVKLGDFGISKELGTN
ANAKTLVGTPYFMSPEVCSGENYGQKADIWAIGCTLYEMVMLKRPFDNDNLNILFNKIRF
EAPPPLHENTSTEIRMLITFMLQKDPVKRPSVWDLAKIPIISKNIRKYYEEEAQDDPFLK
EYIFSGPKNHPNINKNVPKDEKKNTSDNTSKTQDQSQNTNEEMFKALSSALSPYDQKISM
FKVERNVINGKQLFQWIQQYYTNYNTSQVVEMLNELVEKKYLHHIAGPLHQSDPNSLYRF
QFDMPGIAANLTRIWNKTARPALQCLQGIVETANEVLTEVTDKLEGKVFDDKLYQNKKYI
KFLELVCELQKIYLQDTNEQERKCIFINLLQIMYFHKFMKQRYIRMRNEKKEKVTTLFET
LASFLPFFSKSQDEFYYTIGNLQFTLDDIKHGIIRGNKTQKLSSFKPFADNDSRKQFVLT
PDLRILMLFKEENVIPTELKYIKLETMEQQLNEICNKFLSTYVYIDNIENDLTMHKIFQI
YQSDFGPEPQDAIVWASNYTKNLGRVDDLVQNIKSGDIFVQYQEKFES


>TTHERM_00415780(gene)
ATGGCGGATAGATCATATTAAAGTATTCATGTTTTAGTCGCAGAGGATGATAATTTCCAA
AGATTAGCTCTTATAGATATTTTGACCCTTTGCGATTACCAAGTTACTGCTGTAGAAAAC
GGAAGATTAGCTAGGGATGAACTCTTAAAAGCAGATTCAAATATTGATATTGTTCTTTTA
GATCTATACATGCCAGAGATGGATGGTATTGAGTTATTATTATTAATGTAAGAACATGAA
CATTTAAAAAGAATTCCTGTAATTATGATGAGTTTCGATAATGAATAAGAAAGAGTTGCC
TATTGTATTGCAAATGGAGCTAAAGATTATCTTGTTAAACCTCTTAGAATTTAAAACGTT
AAAGGTACAATAATTATTTTAAGTGGGTATTAAAATTATAAAATATGAAAAATAAAATAA
AAAAAAACAAATAGCTGATCTGCAAAATAAGTTTGAAGCTTTTTCTTACTACTTTATCAA
TGCATTTAATTAAATATAGCTAAATATCCCTATTTTAAGAATAGAATGTCTTCCTTTATA
ATATATGAACTAATATCATTTAGTTTTTATGAATTAAATTTTAATTTGATCTATAAAATT
ATGAATTGAAATCCAATAAAATCATGTCTGCAGCATTCAGAAGTTATATATTTTTTTAAA
AATATTTGTAGGTTTAGCAAAATATGTGGAATATAATCCAAACAATACCACAGTAGGAAA
TGGAGGAGTTGGTTTATAGTCTTATAAAGTAATTAGAATGATTGGTTAAGGCGCAGGAGG
AAGTGTAGAGTTAGTTTAAAAAAGAAGCGATGGATAACTTTTTGCTCTCAAAACTATTAG
TATGAAATTCATGGATGACTAGTAAAAAAAAATGGCATAACAGGAAATCACCTTGTTAAA
AGTGCTTGTTGCTCCTTCTATAATTCGTTATTATGAATCTTTTGTGGAAAATGATTCGAT
TCACATGTAAATATATAGAAAATATTAACAAAATGTTAAAAAATGTTTAACTAAAATCTT
ATTTTTTATTAGTATCATGGAATACGCTAAAGAAGGTGCCTTAAGCGATAAAATTACAGA
ACATAAATAAAAAGGAATACCTATAGATGAAGAAACAGTTTTATATTTCACAGCATAGAT
TATTATTTCAGTGCTTTTTATGCACTCTAAAAACATTTTGCACAGAGATATTAAAACTTA
AAATCTCTTTTTGACCAAAGAAAATATAGTTAAGTTAGGAGATTTTGGTATCTCTAAAGA
ATTAGGTACAAATGCAAACGCAAAGACATTAGTTGGTACACCTTATTTCATGTCTCCTGA
AGTATGCAGTGGTGAAAATTATGGATAAAAAGCAGATATTTGGGCTATAGGGTGCACTTT
GTACGAAATGGTCATGCTGAAAAGACCTTTTGATAACGATAACTTGAATATTCTTTTCAA
TAAAATTAGATTTGAAGTATTAATAAAATGTTAGCGCAATTGTTTTATATCATTTTAAAT
AATAAATAAAATAGGCTCCTCCTCCTTTACATGAAAATACTAGTACTGAAATACGTATGC
TTATAACATTCATGCTTTAAAAGGACCCAGTAAAAAGACCTTCTGTTTGGGATTTGGCTA
AAATTCCTATCATATCTAAAAATATCAGAAAATATTATGAAGAAGAAGCTCAAGATGATC
CATTTTTAAAGGAATATATCTTTTCTGGACCTAAAAATCACCCAAATATAAATAAAAATG
TGCCAAAAGACGAAAAGAAAAATACAAGCGATAATACTTCAAAAACTTAAGATTAGTCTT
AAAACACAAATGAAGAGATGTTTAAAGCTCTTAGTTCCGCTTTGTCTCCTTATGACTAGA
AAATTAGCATGTTTAAGGTTGAAAGAAACGTCATAAATGGAAAGTAGTTATTTTAATGGA
TTTAGCAATACTATACAAATTACAATACTTCTCAGGTAGTTGAAATGTTGAATGAGTTAG
TTGAGAAAAAATATCTTCACCACATTGCTGGTCCTTTGCATCAATCTGATCCAAATTCTT
TATATAGATTCTAATTTGATATGCCAGGAATTGCAGCTAATCTGACAAGAATTTGGAATA
AGACTGCTAGACCTGCTCTTTAATGTCTTTAGGGAATTGTAGAAACTGCAAATGAAGTAT
TAACTGAAGTAATTATACTAACTATTTAAAAAAAAGCAAAAAATAAATTTATTTCCTTAA
TTTTTAATATGATAAATAGGTTACAGATAAGCTGGAAGGAAAGGTTTTTGATGATAAGCT
ATATCAAAATAAAAAATATATCAAATTCTTAGAATTGGTTTGTGAGCTGTAAAAAATTTA
TTTGTAAGATACTAATGAACAAGAGAGAAAGTGCATTTTTATCAATTTACTCTAAATTAT
GTATTTCCATAAATTCATGAAGCAAAGATACATCAGAATGAGGAACGAAAAGAAAGAAAA
AGTCACTACTCTTTTTGAGACTTTAGCATCATTTTTGCCTTTCTTTAGCAGTATAATTGA
TCATTTATTTATTAATTCATATATTAAGTAGTTCTTTTACTAATATTAGAAAGTTAAGAT
GAATTTTACTATACTATTGGTAACCTTTAATTCACATTAGATGACATTAAGCATGGTATA
ATAAGAGGTAATAAGACTCAAAAATTAAGCTCATTTAAGCCATTTGCAGACAACGATAGT
AGGAAATAATTTGTTCTAACTCCAGATTTAAGAATTTTGATGCTTTTTAAAGAAGAAAAT
GTCATTCCAACTGAGTTGAAATATATAAAATTAGAAACTATGGAATAGTAGTTAAATGAA
ATTTGCAATAAATTTTTGAGCACATACGTGTACATAGATAATATAGAAAATGATCTAACT
ATGCATAAGATATTCTAAATATATCAAAGCGATTTCGGCCCAGAACCATAAGATGCAATA
GTGTGGGCTTCAAACTACACTAAAAATCTAGGTAGAGTAGACGATTTAGTTTAAAATATA
AAATCAGGAGATATATTTGTATAGTATTAAGAAAAATTTGAATCCTGA