Identifiers and Description

Gene Model Identifier

TTHERM_00146030

Standard Name

NRK23 (NIMA-Related Kinase )

Aliases

PreTt26810 | 11.m00507 | 3702.m00229

Description

NIMA-Related Kinase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00146030

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04670.19.99838497179609e-146hypothetical protein (734 aa)
OxytrichaContig18354.0.g519.997863464222902e-69Protein kinase domain
DictyBaseDDB_G02752411.0004249259458435e-52nek3 on chromosome: 2 position
4983790 to 4987279
WormBaseWBGene000226319.998397555368434e-52locus:nekl-2 status:Confirme
d UniProt:O01775 protein_i
d:CCD64899.1
SGDYHL007C1.0004783691736523e-35STE20 Cdc42p-activated signal
transducing kinase of the PAK
(p21-activated kinase) family;
involved in pheromone respons
e, pseudohyphal/invasive growt
h, vacuole inheritance, down-r
egulation of sterol uptake; GB
B motif binds Ste4p
Stentor CoeruleusSteCoe_160755.380186160021138e-32

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16611747: Wloga D, Camba A, Rogowski K, Manning G, Jerka-Dziadosz M, Gaertig J (2006) Members of the NIMA-related kinase family promote disassembly of cilia by multiple mechanisms. Molecular biology of the cell 17(6):2799-810

Sequences

>TTHERM_00146030(coding)
ATGTCCGCTTTTGATATTTAAGATGACACTCAAGAAAAAATAAATAATAAATACGAAAAG
GTAAAACTTTTAGGTTCTGGAAATCAAGGTAAAGCCTATTTATGCAAGCATGCCTAAACA
AACTAGTAGTTTGTTATTAAACAAATCTAATTAAGCTGCATGAGCGATTAAGAAATTCAA
AAACAATACAAAGAAGTATCTATCTTGAAATCTTTGAGTCATCCAAACATCATAAAATAT
TAAGATTCCTTCTTATTTAAGAAGAATTATTTATGCATAGTCATGGATTACGCAGAAGGT
GGTGATCTAGAATAGAGAATTATTTAAGCATAGAAAGCCAATACACTTTTCGATTGCAAA
ACTATACTAAAGTGGTTCACTTAGCTATGTAGTGCAGTCAGATTCATTCATAATTAAAAA
ATCATTCATAGAGATATTAAGAATAGTAATATTTTTCTTGATTCAAATGATAACATTCTT
TTGGGAGATTTTGGGATCTCGAAGAAGCTTCAGAATCCTAAAGATAAGGCCTCTACTATT
ATTGGAACACCATACTTTATGGCCCCTGAAATATGTAATCAGCAACCTTATACAAATAAA
GTAGATATATGGGCTATAGGTATCGTTCTTTTTAGGCTAGTATATTTAAAATACCCTTTT
GAGGGATTTGAAATATTTCATCTGATGCTTGCAATATCTAGAGGATAGCTTAAATTTCCT
TAAACTCCTTCCTCACCTTTAAAAAACTTAATTTAAAAACTCCTGTAAAATGATCCTAAT
AAAAGGCCATCTATCGAACAAGTATTTGAATTCGAAGAGATTAAATAGTATCTTGACAAA
TCTAGATAAGAAAAACAGATTAATTAAAACTAAACCAGATTGAACTCGTGCAGATAAACT
CGATTGACTAAAGACATAAGCACAGGAAATTTCGAGCTTTAATATAATCGAGCATAATCA
CCCTCCTTAAAAAATATTCAAAAAAGCGAATAAAAATTGTTTGAATTTGCTGTTTAAAAC
TAGTAGAATATCTAAAAAAATATTATACAGAGGCAGATGAGTAAGCATTAGGCGAGAGAT
ATATCACCTGGAATATAAAAAAATCAGAATATAAGTAAATTGCCTTCTCTAAAATCTCCA
AGTTCTTGTCCTTAAAATAATTCAAACTCTAAACAAAAGATTTAATATAATGTTGCTTCT
TCCCCTAATATTATGGGAAAACAGAATTTTGTAAATTTAAAGTACAATTCTAATTTAGAA
AATGAAAAAAATTTTTTAAATAATTTAAATAATAATTATTCGCCTAAAAAATTGAATAAA
TAATATTCTGACTGCAGTACTTCAGATAGCAGTAAAGAAACACCTAAAGTCTTATTTAAT
AATCACAAAGCTGATGAACTTTCACCAGTAATTTAAATATAAAAAGTTATGAGAAATAAT
TTATTTGCTAAGGGCTCTGAAGGATAAGTAAGCTCAAGTTGTAATAACAACCCTTTTTAA
TAGTAAAATTTCTAGCCAAGACTAAAATTTAGTGCAAGAAAATACAACAATGCTATCCGT
TTAAGTGAACAAGTTGTTACTAATACCCCACAATTAAAACCATAGATAATATAAACTCAA
GACAACTCAACTCCATAGTATTTATTTGCTCCTTAAATTAATATCCCTTAGTCATAGCAA
CAGTAATAACAATAATATACTCCAATAATTATAAACTACAAACAGCCTAAAAACGACATA
AAGACAAGACCTTCTCTGAATCTTAAGTAATAGTTTTCAGATAATTCTGTTTCTGTGAAG
GAAAATATTCACTAATAGAACTAGTATATTGAAGCAGTAAAAAAGTAAATGAATAGACCG
AGTAAAGAATTTTAGGTCAACTAATTGCAAGGATAGCAATAACCATAAATAATACATTAA
ATATTTAAATAACCATAAAAAAATCAAGAACCTGAGAATTTTTAGTAAGCTGTGCAAGAT
TTTCATGATGATTTTGAGTAAAATTAAGAAGACCAAATGATCTGCTCTTTAAATACAGTG
CTTTCTCAAGATTTTATAGAAAATAATTAAAATATTTAAGAGAATAATTCAATTGAGAAG
ACTAATATGCTAAGAATCTTCAAAAGAAATAGTAGTAATAATTACAACAGCTAAAACAGT
CACCAATTACAAAACAATGGAAGTAACATTTTAAATCCCAACAACAATAGCAGTGGAAAT
TATGCATTTTAAAATAATATGAGTGGAAGTAGTAGTAATAATAGCTAGAACTTTTACAAC
TTTGGTGCTAATTTGATATCAAATAGCAGTAATTTATTTAATAACCAAAGCAATAACTAG
ATTCCTTAAAGCTTAGACAATAAATAAAATCAAGATTAGTACTAAGATATTTAAGAAATG
TTTAACAAGAACTCTAATTTAAAAACATCTTAAATGCAATTAGAAGACATAGAAAATGAA
AATAATAATTAGTAGCTGCTTAATAACTATTAAGATGATAACCTAGCTATATCATATAAC
TATACAAGATCATCTTTGTCTGACATAAACTCTATTTTATAATCAACTTAAAACAAAGAA
GAAATAGTAGCAAATCCAGAAGAAATAATAGAGTAATTAAAGCAATAATTGATACTATTA
TTAGGCGAAGAACTATTTTTCTAAGTATCTCATTACGCCACTAGACTCATTTTACATTAC
GATATTTCTAAAATAATCAATGAGAATATGCTAAAGGATAACTTCCTTTCATAATGCAAA
TAATATAATTAGGCGAGTTAGCTTATGAATGTTGATCAAATAGTATATAACCTCTTAAAA
ATTGTCAACTATGAAGAAAACAACATTTTAATAGGCTGA


>TTHERM_00146030(protein)
MSAFDIQDDTQEKINNKYEKVKLLGSGNQGKAYLCKHAQTNQQFVIKQIQLSCMSDQEIQ
KQYKEVSILKSLSHPNIIKYQDSFLFKKNYLCIVMDYAEGGDLEQRIIQAQKANTLFDCK
TILKWFTQLCSAVRFIHNQKIIHRDIKNSNIFLDSNDNILLGDFGISKKLQNPKDKASTI
IGTPYFMAPEICNQQPYTNKVDIWAIGIVLFRLVYLKYPFEGFEIFHLMLAISRGQLKFP
QTPSSPLKNLIQKLLQNDPNKRPSIEQVFEFEEIKQYLDKSRQEKQINQNQTRLNSCRQT
RLTKDISTGNFELQYNRAQSPSLKNIQKSEQKLFEFAVQNQQNIQKNIIQRQMSKHQARD
ISPGIQKNQNISKLPSLKSPSSCPQNNSNSKQKIQYNVASSPNIMGKQNFVNLKYNSNLE
NEKNFLNNLNNNYSPKKLNKQYSDCSTSDSSKETPKVLFNNHKADELSPVIQIQKVMRNN
LFAKGSEGQVSSSCNNNPFQQQNFQPRLKFSARKYNNAIRLSEQVVTNTPQLKPQIIQTQ
DNSTPQYLFAPQINIPQSQQQQQQQYTPIIINYKQPKNDIKTRPSLNLKQQFSDNSVSVK
ENIHQQNQYIEAVKKQMNRPSKEFQVNQLQGQQQPQIIHQIFKQPQKNQEPENFQQAVQD
FHDDFEQNQEDQMICSLNTVLSQDFIENNQNIQENNSIEKTNMLRIFKRNSSNNYNSQNS
HQLQNNGSNILNPNNNSSGNYAFQNNMSGSSSNNSQNFYNFGANLISNSSNLFNNQSNNQ
IPQSLDNKQNQDQYQDIQEMFNKNSNLKTSQMQLEDIENENNNQQLLNNYQDDNLAISYN
YTRSSLSDINSILQSTQNKEEIVANPEEIIEQLKQQLILLLGEELFFQVSHYATRLILHY
DISKIINENMLKDNFLSQCKQYNQASQLMNVDQIVYNLLKIVNYEENNILIG


>TTHERM_00146030(gene)
ATTAAAAATATAAAATATATACATATATTAGAAAAATCAACACTCTCTCAACTCTTTAAT
AGTTTATTGGTTAAATATCTAAGGAAAAGATACACTTAAAAAAATTTAAATATTTCTTTC
TAAAAAGTAATGCATTTTTTTAAAATCTTAATTATATAATCTCCAAGAGCTAAGATTGAA
TTTTCTATCTTCTACTTTTCTATATAAATTTACTGATAAATTAACAAATTTAAATATTGA
GTTATATTTAGTATTTCAAAGAATACCAAAGCTTACATTAACTAAAAATAAGATTACAAC
ATATACTACTTGGCTTATAATTTATATAGATCAGCTTATTTACTTAGTATTTGTATAAAA
AGATTAATAAGATGTCCGCTTTTGATATTTAAGATGACACTCAAGAAAAAATAAATAATA
AATACGAAAAGGTAAAACTTTTAGGTTCTGGAAATCAAGGTAAAGCCTATTTATGCAAGC
ATGCCTAAACAAACTAGTAGTTTGTTATTAAACAAATCTAATTAAGCTGCATGAGCGATT
AAGAAATTCAAAAACAATACAAAGAAGTATCTATCTTGAAATCTTTGAGTCATCCAAACA
TCATAAAATATTAAGATTCCTTCTTATTTAAGAAGAATTATTTATGCATAGTCATGGATT
ACGCAGAAGGTAAATAATTCAACATTCAACTTTACAAAAATGCACACAATTGCTTTATTT
AGAAGCAGAAACCATCATACAAACAATTATAATATGCTTTTCATATTCACTGAAGAATAA
AAATAAAAATTTTTGCTACAAATATGGATTTCATTTTTAGAAATTTTGATAATATAGTGT
ATTAGTAGTTTATAGTTTTAATTAAAGATTCAATAGCAAGTAAATGCATTAGTGGAGTTC
ATGGATATTATTGATGATTACTAATTAATTATCTTAGTAATCAATCGTATATTTATTATT
GTTATCCAGTTTCTTAATTAATTTTTAAATCATAAAATTTAAAAATTGAAAGATTTTACA
ATCAGAGTATCTAATAAATCATTTATTTATCAATAGCAACAATCACAAAAAAAAATTAGC
ATTTCAATGATCAATTTTTCATATAAATTTTATAATATTTAATACTTGAAAAATTATAAA
GATGTATTTGAGATTTATCTTTCATTCCATACCTCTGAATCTAAATTACGGATTATTCTT
TATAAAATTTAAATTTATTAACACTTCTTTATTTCAGAAACTCCCTATCGAAATCTTGCA
AAAATATAATCCTCTCTTTTAGATATTTAAATATCTGAAATATAATAATTAATAAATTTA
AATAACTAAATAAGAAGTAGATTATTTTATAATTATGAATTAATGACTGACTGCTATAAT
AAATTAGTTTACATTTTATAAATTTATTTTAAATATTTAAAGGTGGTGATCTAGAATAGA
GAATTATTTAAGCATAGAAAGCCAATACACTTTTCGATTGCAAAACTATACTAAAGTGGT
TCACTTAGCTATGTAGTGCAGTCAGATTCATTCATAATTAAAAAATCATTCATAGAGATA
TTAAGAATAGTAATATTTTTCTTGATTCAAATGATAACATTCTTTTGGGAGATTTTGGGA
TCTCGAAGAAGCTTCAGAATCCTAAAGATAAGGCCTCTACTATTATTGGTAAGGATCAAA
TATTTGTTTATTTAATTAATTAAATAATTTAAATTTTCTAATGAATTAAAATTTTATTTT
TAATAAATTTATAAAGGAACACCATACTTTATGGCCCCTGAAATATGTAATCAGCAACCT
TATACAAATAAAGTAGATATATGGGCTATAGGTATCGTTCTTTTTAGGCTAGTATATTTA
AAATACCCTTTTGAGGGATTTGAAATATTTCATCTGATGCTTGCAATATCTAGAGGATAG
CTTAAATTTCCTTAAACTCCTTCCTCACCTTTAAAAAACTTAATTTAAAAACTCCTGTAA
AATGATCCTAATAAAAGGCCATCTATCGAACAAGTATTTGGTAAAAGAATATACTTTTAT
TTTAAAAATAATTCATCGTATTGTTTTAATTAAAAAACGAAAAAGATTATTCTTAATATT
AACTTTATAACTTTTTTATATTTAAAAAGAATTCGAAGAGATTAAATAGTATCTTGACAA
ATCTAGATAAGAAAAACAGATTAATTAAAACTAAGTAATAGTTTCTTTAATTTCTTTTCA
ATTATTTACCTTAATTAATTAATTTATTAATTATTTAAAATTTAAATATTTAACTTAATT
TTTAGACCAGATTGAACTCGTGCAGATAAACTCGATTGACTAAAGACATAAGCACAGGAA
ATTTCGAGCTTTAATATAATCGAGCATAATCACCCTCCTTAAAAAATATTCAAAAAAGCG
AATAAAAATTGTTTGAATTTGCTGTTTAAAACTAGTAGAATATCTAAAAAAATATTATAC
AGAGGCAGATGAGTAAGCATTAGGCGAGAGATATATCACCTGGAATATAAAAAAATCAGA
ATGTATTGATTTATTTAATAATTTTTAATTGTTTCGAATTTATTAGTCTCAACATTTATT
TATTTAAAAAATATAGATAAGTAAATTGCCTTCTCTAAAATCTCCAAGTTCTTGTCCTTA
AAATAATTCAAACTCTAAACAAAAGATTTAATATAATGTTGCTTCTTCCCCTAATATTAT
GGGAAAACAGAATTTTGTAAATTTAAAGTACAATTCTAATTTAGAAAATGAAAAAAATTT
TTTAAATAATTTAAATAATAATTATTCGCCTAAAAAATTGAATAAATAATATTCTGACTG
CAGTACTTCAGATAGCAGTAAAGAAACACCTAAAGTCTTATTTAATAATCACAAAGCTGA
TGAACTTTCACCAGTAATTTAAATATAAAAAGTTATGAGAAATAATTTATTTGCTAAGGG
CTCTGAAGGATAAGTAAGCTCAAGTTGTAATAACAACCCTTTTTAATAGTAAAATTTCTA
GCCAAGACTAAAATTTAGTGCAAGAAAATACAACAATGCTATCCGTTTAAGTGAACAAGT
TGTTACTAATACCCCACAATTAAAACCATAGATAATATAAACTCAAGACAACTCAACTCC
ATAGTATTTATTTGCTCCTTAAATTAATATCCCTTAGTCATAGCAACAGTAATAACAATA
ATATACTCCAATAATTATAAACTACAAACAGCCTAAAAACGACATAAAGACAAGACCTTC
TCTGAATCTTAAGTAATAGTTTTCAGATAATTCTGTTTCTGTGAAGGAAAATATTCACTA
ATAGAACTAGTATATTGAAGCAGTAAAAAAGTAAATGAATAGACCGAGTAAAGAATTTTA
GGTCAACTAATTGCAAGGATAGCAATAACCATAAATAATACATTAAATATTTAAATAACC
ATAAAAAAATCAAGAACCTGAGAATTTTTAGTAAGCTGTGCAAGATTTTCATGATGTAAT
GAAATATTTAACTTTTTACAAAATTAAATAGGAAATAAAAATATTTATTTTTTAAATTAA
TTAGGATTTTGAGTAAAATTAAGAAGACCAAATGATCTGCTCTTTAAATACAGTGCTTTC
TCAAGATTTTATAGAAAATAATTAAAATATTTAAGAGAATAATTCAATTGAGAAGACTAA
TATGCTAAGAATCTTCAAAAGAAATAGTAGTAATAATTACAACAGCTAAAACAGTCACCA
ATTACAAAACAATGGAAGTAACATTTTAAATCCCAACAACAATAGCAGTGGAAATTATGC
ATTTTAAAATAATATGAGTGGAAGTAGTAGTAATAATAGCTAGAACTTTTACAACTTTGG
TGCTAATTTGATATCAAATAGCAGTAATTTATTTAATAACCAAAGCAATAACTAGATTCC
TTAAAGCTTAGACAATAAATAAAATCAAGATTAGTACTAAGATATTTAAGAAATGTTTAA
CAAGAACTCTAATTTAAAAACATCTTAAATGCAATTAGAAGACATAGAAAATGAAAATAA
TAATTAGTAGCTGCTTAATAACTATTAAGATGATAACCTAGCTATATCATATAACTATAC
AAGATCATCTTTGTCTGACATAAACTCTATTTTATAATCAACTTAAAACAAAGAAGAAAT
AGTAGCAAATCCAGAAGAAATAATAGAGGTAACTATCTATTTATTATACAAATATTTTTA
ATAAAACATTTCTCTAATATATTTTTTTTTATAGTAATTAAAGCAATAATTGATACTATT
ATTAGGCGAAGAACTATTTTTCTAAGTATCTCATTACGCCACTAGACTCATTTTACATTA
CGATATTTCTAAAATAATCAATGAGAATATGCTAAAGGATAACTTCCTTTCATAATGCAA
ATAATATAATTAGGCGAGTTAGCTTATGAATGTTGATCAAATAGTATATAACCTCTTAAA
AATTGTCAACTATGAAGAAAACAACATTTTAATAGGCTGA