Identifiers and Description

Gene Model Identifier

TTHERM_00390060

Standard Name

NRK22 (NIMA-Related Kinase)

Aliases

PreTt24902 | 41.m00309

Description

Protein kinase domain containing protein. Sequence similarity to the NEK protein kinase family (Eisen et al., 2006).";NIMA-Related Kinase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF06519 ) TolA protein
  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase
  • ( PF01636 ) Phosphotransferase enzyme family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00390060

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04541.19.997093137033517e-262protein kinase domain-containi
ng protein (878 aa)
OxytrichaContig19374.0.g852.9995308115992368e-117Protein kinase domain
DictyBaseDDB_G02892771.000296925633081e-74nek4 on chromosome: 5 position
2561379 to 2563106
Stentor CoeruleusSteCoe_379989.710436457780846e-67
WormBaseWBGene000214612.0008958828286524e-54locus:nekl-1 status:Partiall
y_confirmed UniProt:Q6AW07
protein_id:CCD69902.1
SGDYAR018C4.000139296874041e-45KIN3 Nonessential serine/threo
nine protein kinase; possible
role in DNA damage response

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16611747: Wloga D, Camba A, Rogowski K, Manning G, Jerka-Dziadosz M, Gaertig J (2006) Members of the NIMA-related kinase family promote disassembly of cilia by multiple mechanisms. Molecular biology of the cell 17(6):2799-810

Sequences

>TTHERM_00390060(coding)
ATGGAAGTCTATGAGACTGTAAAATTGATTGGATCGGGTGCATTCGGTCAAGTCTATTTA
GTGAAGCATAAGCGTGAAGACAAAATGTATGTCAATAAAAAGATTAAAACAAGAGATATG
AGTCAAAAAGATAGGGAGAACACAGAGAATGAAGTACGCTTGTTGTAAAAATTAAGACAT
GCTAACATTGTAGCATATAAAGATAGTTATATGGATAGAGAGCAGTATTTAAATATTGTT
ATGATTCATTGTGAAGGAGGAGATATGCATAATAGAATTAAAAATTAAAAAGGAAAAAAT
TTTCCCGAAGATTAGATTTAGGATTGGTTAGCATAAATGGCATTAGCGCTTTTTTATTTG
CATGAAAAGAAAATATTACATAGAGATCTTAAAACCCAAAATATTTTTTTAAAGAGCGGC
AGAGTAAGACTAGGTGATTTTGGTATAGCAAAAGTACTTGATTCAACTAGAGACTTCGCA
AATACATGCATTGGTACTCCTTATTATATGTCTCCAGAGTTATTTAAGTACAAACCTTAT
AGTTACAAAAGTGATATTTGGGCATTTGGTTGTGTGCTTTATGAAATGTGTAATCTAAGA
CATGCATTTGATGCTTAAAGTTTAAATGGATTAGCAGTCAAGATTATGAATGGTACATAC
CCGCCTATAAATTCTACTTATTCCAAGTCTTTAAGAGATTTAATTGGCAAAATGCTTTAA
CTTAATCCTAAAAGTAGACCTTCTATTTTAGATATTATAAACACGTCCTTTGTTAAACGT
AGGATCATATCTTACATCACAGATCTATTAAGTGGAAACTTGACAGATCCTAATATTATT
AATGATGTTGATGATCTCTATTTTGATAGTCTAAGGGATTAAGCTTAAAAACTTGGTATT
CTTTAAATTATTAATTAAAATCTTTCTAAAAATGGCCCAGCTTTACCAATTAGTGATGAG
TAGCTTAGACCTCCATAGAGGGTTGGTTAAAGATAGCAAGGGACTGATAGAAAAGTGATT
GAACAAAAGCAAAAAGCTAAAAAGGAATTGTAGAAATAGATTAATGAAAAAAATAGAATT
GAATAGGAAATTAAAAGGTTAGAAAAGAAAAAAATGGTTAGAAGCTCTAGCACAAATATC
AAACAGCCATAGCAGTAAAGTCAATAAAGTGATTCCAGATAAAATATTAAAAAGACAGAA
AATGATCGTCGTGACAAAAAAGAAAGGGATCGTAGCTATTCCTTGGAAAGGGAAAGCTCT
GTCAAATAGCGTAAACCTTTATAAAATTAACAGCAGTAATCTGTAAATCAATCAAAATCT
TCAGTTAATTCCATAAGAAATGAAGTGAAGAGAGTTAGATAATAGATAGATTCATCATCA
TCAACAAGTGCTGAATCTGATGTAGTCTCAACCAAAGTAACCCCTTCAGTTAGGCAGAGT
GCTGAGTAAAGTTATAATGAATAAAAAAATGTGGATCGTAGAGAATAAATTAGACAAGAG
TAGGAGAGAAAAAAGAAATAAGAACAGGAAGAAATGGAATAATAGAGGAAATAAATTATT
TAAGAAAATATTTAAGCAAGGTAAAAAGCTGTTTAATTATAATAAGCCTAATACAGGCCA
TCTAAAGACAATATGGTTTTTATGAATGATGAGGAGGAAAAGCAATAGCAGCAGTAATAA
AACTAAATGTAAGGATTTGTCAAAAGAGGTAGTCTTTAGTCATTTGAATATTCAAAAAAG
TAAAATGGTAACCCTGTTGACGACTTCTCCATAGATATTAATGAGCGTGAAAGCTTCGAT
TATAAATCTAGTATAGATTAAAATTCAAATATTTATAACTCTGAGAGATATGCACCTCCA
ATGTAAAATAACAGCTAAGTAAATAACAATTATTAAGATGAGAGATATACTTAGCAACAA
CAGTAGCAAAGACCTTAATAATAGTATCCTTACAAAATTTAAGAAGAAGAGGATTAAATT
ATAGATATAAATGAAATCATAGGAGAAAATAATGAAGAAAATGATGATGATGCATTATAA
TCAGTAATCCATGAAGAAGAAAATGAAGAATCAGATGATGAAGTAGAAGAGGACCCAAAT
AAAATAGAAGAAAAATTAGAATTAATGAAAACAAAGCTTAAGGAAAAAACGATTAAAATC
AATACAATCACTAATTTCCTCAATTAATCTAGGAAGCAAGCAACTCTTTAAAAGAACCAA
ATCAGTCAGTAAATGCAAAATTAAGATTAAGAAGAAGGGCATATCATCCCAGAAGATCAA
TAAAGTGAAGAAGATGATAATAATTACTATGATGATGAGGATTTAGATGATGATGATAAT
TATGATGAAAACGAAGGAGAAGTTATTTAAGAGTTTTAACAAAACAATAACCCATAATAT
TTCAAAATTTAAGATAAAATAAAACTATTTAGACACAGATGTGAAGCCAGTTTAGGAATA
GTAATGTTTGATAAAGCTTATGATTATCTCAAAGTAAATAGTAATAAATGTTCGACCGAT
GAATTAAGAAAGTAGCTAGTAGAAATTTTATCAGAGGAAAATATTGGCTTTTGGCATTTA
ATCGACTAAATATTATTTTTAGAAGAAGTTTTGTAGACTATCCCATCATAAATATAAAAA
TGA


>TTHERM_00390060(protein)
MEVYETVKLIGSGAFGQVYLVKHKREDKMYVNKKIKTRDMSQKDRENTENEVRLLQKLRH
ANIVAYKDSYMDREQYLNIVMIHCEGGDMHNRIKNQKGKNFPEDQIQDWLAQMALALFYL
HEKKILHRDLKTQNIFLKSGRVRLGDFGIAKVLDSTRDFANTCIGTPYYMSPELFKYKPY
SYKSDIWAFGCVLYEMCNLRHAFDAQSLNGLAVKIMNGTYPPINSTYSKSLRDLIGKMLQ
LNPKSRPSILDIINTSFVKRRIISYITDLLSGNLTDPNIINDVDDLYFDSLRDQAQKLGI
LQIINQNLSKNGPALPISDEQLRPPQRVGQRQQGTDRKVIEQKQKAKKELQKQINEKNRI
EQEIKRLEKKKMVRSSSTNIKQPQQQSQQSDSRQNIKKTENDRRDKKERDRSYSLERESS
VKQRKPLQNQQQQSVNQSKSSVNSIRNEVKRVRQQIDSSSSTSAESDVVSTKVTPSVRQS
AEQSYNEQKNVDRREQIRQEQERKKKQEQEEMEQQRKQIIQENIQARQKAVQLQQAQYRP
SKDNMVFMNDEEEKQQQQQQNQMQGFVKRGSLQSFEYSKKQNGNPVDDFSIDINERESFD
YKSSIDQNSNIYNSERYAPPMQNNSQVNNNYQDERYTQQQQQQRPQQQYPYKIQEEEDQI
IDINEIIGENNEENDDDALQSVIHEEENEESDDEVEEDPNKIEEKLELMKTKLKEKTIKI
NTITNFLNQSRKQATLQKNQISQQMQNQDQEEGHIIPEDQQSEEDDNNYYDDEDLDDDDN
YDENEGEVIQEFQQNNNPQYFKIQDKIKLFRHRCEASLGIVMFDKAYDYLKVNSNKCSTD
ELRKQLVEILSEENIGFWHLIDQILFLEEVLQTIPSQIQK


>TTHERM_00390060(gene)
ATGGAAGTCTATGAGACTGTAAAATTGATTGGATCGGGTGCATTCGGTCAAGTCTATTTA
GTGAAGCATAAGCGTGAAGACAAAATGTATGTCAATAAAAAGATTAAAACAAGAGATATG
AGTCAAAAAGATAGGGAGAACACAGAGAATGAAGTACGCTTGTTGTAAAAATTAAGACAT
GCTAACATTGTAGCATATAAAGATAGTTATATGGATAGAGAGCAGTATTTAAATATTGTT
ATGATTCATTGTGAAGGAGGAGATATGCATAATAGAATTAAAAATTAAAAAGGAAAAAAT
TTTCCCGAAGATTAGATTTAGGATTGGTTAGCATAAATGGCATTAGCGCTTTTTTATTTG
CATGAAAAGAAAATATTACATAGAGATCTTAAAACCCAAAATATTTTTTTAAAGAGCGGC
AGAGTAAGACTAGGTGATTTTGGTATAGCAAAAGTACTTGATTCAACTAGAGACTTCGCA
AATACATGCATTGGTAATGAGCGATAAACTTTTCTATATTATATACTTTTGAAATTTAAA
ACAAAAGAGTAGAATTTAAATTATAAAAATACCTAAAAATTAATTTTATTGCTTGTTTAA
AAAAGATTAGCTATTTTTAATTCATTTATTATTTTTAAAAAGGTACTCCTTATTATATGT
CTCCAGAGTTATTTAAGTACAAACCTTATAGTTACAAAAGTGATATTTGGGCATTTGGTT
GTGTGCTTTATGAAATGTGTAATCTAAGACATGCATTTGATGCTTAAAGTTTAAATGGAT
TAGCAGTCAAGATTATGAATGGTACATACCCGCCTATAAATTCTACTTATTCCAAGTCTT
TAAGAGATTTAATTGGCAAAATGCTTTAACTTAATCCTAAAAGTAGACCTTCTATTTTAG
ATATTATAAACACGTCCTTTGTTAAACGTAGGATCATATCTTACATCACAGATCTATTAA
GTGGAAACTTGACAGATCCTAATATTATTAATGATGTAAAACTAGATTGATTCACATCTC
TTTTTGCATTTTATTTGCTTATGCCCAAAATTGTATTGAATACATATTATTTTTGTAAAT
TAAAAGGTTGATGATCTCTATTTTGATAGTCTAAGGGATTAAGCTTAAAAACTTGGTATT
CTTTAAATTATTAATTAAAATCTTTCTAAAAATGGCCCAGCTTTACCAATTAGTGATGAG
TAGCTTAGACCTCCATAGAGGGTTGGTTAAAGATAGCAAGGGACTGATAGAAAAGTGATT
GAACAAAAGCAAAAAGCTAAAAAGGAATTGTAGAAATAGATTAATGAAAAAAATAGAATT
GAATAGGAAATTAAAAGGTTAGAAAAGAAAAAAATGGTTAGAAGCTCTAGCACAAATATC
AAACAGCCATAGCAGTAAAGTCAATAAAGTGATTCCAGATAAAATATTAAAAAGACAGAA
AATGATCGTCGTGACAAAAAAGAAAGGGATCGTAGCTATTCCTTGGAAAGGGAAAGCTCT
GTCAAATAGCGTAAACCTTTATAAAATTAACAGCAGTAATCTGTAAATCAATCAAAATCT
TCAGTTAATTCCATAAGAAATGAAGTGAAGAGAGTTAGATAATAGATAGATTCATCGTAA
AATTATTATTTTCTTATGTATAATTTAAAAATTACCTTAAATATTTTATTTAGATCATCA
ACAAGTGCTGAATCTGATGTAGTCTCAACCAAAGTAACCCCTTCAGTTAGGCAGAGTGCT
GAGTAAAGTTATAATGAATAAAAAAATGTGGATCGTAGAGAATAAATTAGACAAGAGTAG
GAGAGAAAAAAGAAATAAGAACAGGAAGAAATGGAATAATAGAGGAAATAAATTATTTAA
GAAAATATTTAAGCAAGGTAAAAAGCTGTTTAATTATAATAAGCCTAATACAGGCCATCT
AAAGACAATATGGTTTTTATGAATGATGAGGAGGAAAAGCAATAGCAGCAGTAATAAAAC
TAAATGTAAGGATTTGTCAAAAGAGGTAGTCTTTAGTCATTTGAATATTCAAAAAAGTAA
AATGGTAACCCTGTTGACGACTTCTCCATAGATATTAATGAGCGTGAAAGCTTCGATTAT
AAATCTAGTATAGATTAAAATTCAAATATTTATAACTCTGAGAGATATGCACCTCCAATG
TAAAATAACAGCTAAGTAAATAACAATTATTAAGATGAGAGATATACTTAGCAACAACAG
TAGCAAAGACCTTAATAATAGTATCCTTACAAAATTTAAGAAGAAGAGGATTAAATTATA
GATATAAATGAAATCATAGGAGAAAATAATGAAGAAAATGATGATGATGTAAAAATAAAA
ACTCACCATATTATTTATTTAATATTTTCATATCTTCTAGGCATTATAATCAGTAATCCA
TGAAGAAGAAAATGAAGAATCAGATGATGAAGTAGAAGAGGACCCAAATAAAATAGAAGA
AAAATTAGAATTAATGAAAACAAAGCTTAAGGAAAAAACGATTAAAATCAATACAATCAC
TAATTTCCTCAATTAATCTAGGAAGCAAGCAACTCTTTAAAAGAACCAAATCAGTCAGTA
AATGCAAAATTAAGATTAAGAAGAAGGGCATATCATCCCAGAAGATCAATAAAGTGAAGA
AGATGATAATAATTACTATGATGATGAGGATTTAGATGATGATGATAATTATGATGAAAA
CGAAGGAGAAGTTATTTAAGAGTTTTAACAAAACAATAACCCATAATATTTCAAAATTTA
AGATAAAATAAAACTATTTAGACACAGATGTGAAGCCAGTTTAGGAATAGTAATGTTTGA
TAAAGCTTATGATTATCTCAAAGTAAATAGTAATAAATGTTCGACCGATGAATTAAGAAA
GTAGCTAGTAGAAATTTTATCAGAGGAAAATATTGGCTTTTGGCATTTAATCGACTAAAT
ATTATTTTTAGAAGAAGTTTTGTAGACTATCCCATCATAAATATAAAAATGA