Identifiers and Description

Gene Model Identifier

TTHERM_00151480

Standard Name

NRK20 (NIMA-Related Kinase )

Aliases

PreTt20809 | 12.m00483 | 3700.m00203

Description

NIMA-Related Kinase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00151480

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05104.17.997133821356313e-142hypothetical protein (1234 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16611747: Wloga D, Camba A, Rogowski K, Manning G, Jerka-Dziadosz M, Gaertig J (2006) Members of the NIMA-related kinase family promote disassembly of cilia by multiple mechanisms. Molecular biology of the cell 17(6):2799-810

Sequences

>TTHERM_00151480(coding)
ATGTGGTAATTAATTCATTAAATTAAGTAGACTTTAAAAAAGTAAAAGAAAAATAAAAAA
AGTAAAAAATATTTAAAGCTCTAATTGAATCGATTTATTATCTATTTGATTATGGAAAAA
AAAGATAAAGATATAGTCAGAGGATGCTAAAAATTTAAAGAAAAATTTAAATACTATAGT
AATAGCGATAAAGAAGCTATCATTTTCTTAAAATTGAGAAATGAAGGATGTCCCAGAAAG
CCTGCCCTCAGGTTTAGTTCTAAAACTGTATGCAAATCAGACTCTACTCGTACTATATTT
GGTCCTCGAAATCACAGGATACTCTAGGTTCAGCAACTACCTAGTTATTCACTTTAAAAT
GGATGGTTCTAAGGAAATCTATACTATAATATGGACAATGAATTCAAGCTGAGTTATAAG
GATATACTGCAGGAAGATATTTAAGATGATAACTTGAAAGTTTTATTTAACAAAAATGAA
GAATAAGCTAAAGAATAATTTAAGAAAATGTTATAAATCACTAAATAGTATTTTGATGAA
ATATCTTAGATATGCACTATTAATAGAGGAAATTCTAAAGAAGAATATTTAAAGAGTATT
CAAAATTTTATTTAGAACACACGCAAGCAACTTAAAACGCAAACATATTTTGAATACAAG
AATATAAAGTTTTATTATTTGTCTAGTATGTTATAATCTATTTTGGATAATGAAAAGAAA
TCTTCTGAAGAAATAGAGAGCATAATATAAAAGTACAATGTATTCAACGATGTTTTAAGA
TAGCCAGATATTAAAAGTTTAGATATCAAGTAAGAAGACAATAAGAATAAAGAATAATCT
TAATAACTAATGTCTCCAAGCTCAAAGTCTGGAAAGAATCTATTTGGATTGAGAAAGTAA
AATAACTAAAGCTCAAAGGAAAAATTACTAAATACAAGCTTAAGTGATAATAGCATGATG
ATGACTCTCAAAAGCTCACCAAAAGTGGGACTGCTATAAGGGTCATCAGATGATATTAAT
CTTCCTGATTTAACTTTGTAAAATTCTTCACATTAACAAACATCTATAGGACCTTTTGAC
TATATGTCAAGTGATTCAATAAATAGCTAAGAGCGTATACAAAGCTAAGAAGATAAATCT
GTTTATGGAGATGGTGATATGTCACCTAAGAGTTCTACGTATACTGATTCCTCATTTAAA
AAGTCAAACATTAGTTTCATAAATAGTGCAGCTCAGCAGCTAAAGCTACTACAATAAATG
GATCAAACTAATTAAGACTTGTTCTCCAATACTCCATTGACTAAACTAGAAAGAGTATAA
TTCATAGAAGGTTCAGCTGAAAGTAAAAGGTTACTTGAGTAATAATTTAATGATGCATAA
TATTTTTATTAATATTAATAGCAAAATAATAAATCATTTGATAACAAAAATCAAAATAAT
CAAAATAAAAAAAAAGATGTAAAGAGTAAAGCTAAAATATATACAAATGAAAATGTTAGC
AGTAAAAATAAGTAAATTAGAAAATTTTAAAGCTTATTAAAGGTAGATGCTGATTTAGAG
AAAGAATTCTTAAAATTAGCCTAGTGTGAATAATATCAAATAAAACCTGAAGATATTTAA
AAATAAAATAATTTTTAAAATTAAAAGCAATTAGAAATTTAGTAACAACCTCCTTCTCCA
AATACTTAAAAAATGAGTCTTTTTCAAAAGGATTTTGTTGAATCGTCTAAAAACATAGAA
AGAAGTAGCAGAAACAAGGAAGAAAAAATCATGTTTTCACCTACAAAAAGTTCATAACAT
ATTAATAGTAGTTAATAGAAAATAGATGTTTTGAATAAAACAGATAGTTTTAATCTATAA
AAGCTTGTTGAAAAAAAAAAATAAATGTTAGCTGCTTTTAGGAAGAGAAATTATAAGAAT
TTAAGCAACTAGTTTCCTTTAAATTAAGAAGCAATTAAAGCTCCTTCAAACATATACTTT
TAAATTCTTCAATCAAAACCTGATAAATTCTCTCATTAAAGAAATCAAACATACTCAAAT
GATACAAATTCATTATTGTAAACTGCTAAGGTTGAAAATAATTTTCCTGTGTAAAATAAA
TTCCCTTAAAAATATATTTAAGAAAATGAGAATTACTTTACAATGAAGAACAAATATCAA
GCAAAAAAACATTAAAAATCTCAATAAACTTAGGTTTCAGTAACTAGTACAAAAAATAAT
TTTAACAAATCAACAAATGATGAAACATAGAAAGATTGTGTAAAGGACTAAAGAGTCAAA
ACTCAATCAAGTTATTTTTTATATAAAAAGTAAGAATAGCAAAGTAGTTATATCACAAAT
AGTTAGAGACTGTCTTTATCTATTAAGTCTAATATGAATAAGACATAAAATATTTTTGAA
AATTTAGAAAGAGCAAGAAAACCAAAAATTGATAATTTTTTCAATTAAAAAAAATGA


>TTHERM_00151480(protein)
MWQLIHQIKQTLKKQKKNKKSKKYLKLQLNRFIIYLIMEKKDKDIVRGCQKFKEKFKYYS
NSDKEAIIFLKLRNEGCPRKPALRFSSKTVCKSDSTRTIFGPRNHRILQVQQLPSYSLQN
GWFQGNLYYNMDNEFKLSYKDILQEDIQDDNLKVLFNKNEEQAKEQFKKMLQITKQYFDE
ISQICTINRGNSKEEYLKSIQNFIQNTRKQLKTQTYFEYKNIKFYYLSSMLQSILDNEKK
SSEEIESIIQKYNVFNDVLRQPDIKSLDIKQEDNKNKEQSQQLMSPSSKSGKNLFGLRKQ
NNQSSKEKLLNTSLSDNSMMMTLKSSPKVGLLQGSSDDINLPDLTLQNSSHQQTSIGPFD
YMSSDSINSQERIQSQEDKSVYGDGDMSPKSSTYTDSSFKKSNISFINSAAQQLKLLQQM
DQTNQDLFSNTPLTKLERVQFIEGSAESKRLLEQQFNDAQYFYQYQQQNNKSFDNKNQNN
QNKKKDVKSKAKIYTNENVSSKNKQIRKFQSLLKVDADLEKEFLKLAQCEQYQIKPEDIQ
KQNNFQNQKQLEIQQQPPSPNTQKMSLFQKDFVESSKNIERSSRNKEEKIMFSPTKSSQH
INSSQQKIDVLNKTDSFNLQKLVEKKKQMLAAFRKRNYKNLSNQFPLNQEAIKAPSNIYF
QILQSKPDKFSHQRNQTYSNDTNSLLQTAKVENNFPVQNKFPQKYIQENENYFTMKNKYQ
AKKHQKSQQTQVSVTSTKNNFNKSTNDETQKDCVKDQRVKTQSSYFLYKKQEQQSSYITN
SQRLSLSIKSNMNKTQNIFENLERARKPKIDNFFNQKK


>TTHERM_00151480(gene)
ACTAATTAATTAAATTAGATTAATTAATCAAATTCTACTTCACAATTTAAGTTCTTTGAA
ATAAAAAAAATAATAAAGGGAAACTATATATTAATAGATAATGCTTCGATTTATATTAGA
AATATATAAAAAGAGTTAGTAATAGATAGATTGTCTATGTGGTAATTAATTCATTAAATT
AAGTAGACTTTAAAAAAGTAAAAGAAAAATAAAAAAAGTAAAAAATATTTAAAGCTCTAA
TTGAATCGATTTATTATCTATTTGATTATGGAAAAAAAAGATAAAGATATAGTCAGAGGA
TGCTAAAAATTTAAAGAAAAATTTAAATACTATAGTAATAGCGATAAAGAAGCTATCATT
TTCTTAAAATTGAGAAATGAAGGATGTCCCAGAAAGCCTGCCCTCAGGTTTAGTTCTAAA
ACTGTATGCAAATCAGACTCTACTCGTACTATATTTGGTCCTCGAAATCACAGGATACTC
TAGGTTCAGCAACTACCTAGTTATTCACTTTAAAATGGATGGTTCTAAGGAAATCTATAC
TATAATATGGGTAAGTTTTTTATTCAATTAAAGGCAAAAATTAGACAAAAAAGTTAAGTA
GAACATTTATGATTAAATATAAATAAATGCTTTATTAATGAAAAAATTTTACAATTTTAT
TTGATATTATAACGAAATAGACAATGAATTCAAGCTGAGTTATAAGGATATACTGCAGGA
AGATATTTAAGATGATAACTTGAAAGTTTTATTTAACAAAAATGAAGAATAAGCTAAAGA
ATAATTTAAGAAAATGTTATAAATCACTAAATAGTATTTTGATGAAATATCTTAGATATG
CACTATTAATAGAGGAAATTCTAAAGAAGAATATTTAAAGAGTATTCAAAATTTTATTTA
GAACACACGCAAGCAACTTAAAACGCAAACATATTTTGAATACAAGAATATAAAGTAAAG
CTTTCTTATATTTTTTAGCTCGGATGGATGGTTTATCAATTTTTTTTAAAAAGGTTTTAT
TATTTGTCTAGTATGTTATAATCTATTTTGGATAATGAAAAGAAATCTTCTGAAGAAATA
GAGAGCATAATATAAAAGTACAATGTATTCAACGATGTTTTAAGATAGCCAGATATTAAA
AGTTTAGATATCAAGTAAGAAGACAATAAGAATAAAGAATAATCTTAATAACTAATGTCT
CCAAGCTCAAAGTCTGGAAAGAATCTATTTGGATTGAGAAAGTAAAATAACTAAAGCTCA
AAGGAAAAATTACTAAATACAAGCTTAAGTGATAATAGCATGATGATGGTAATATATCAA
AATATATACATAGATTATTTTTAAATATTTATTTAAATTTATTAATAGACTCTCAAAAGC
TCACCAAAAGTGGGACTGCTATAAGGGTCATCAGATGATATTAATCTTCCTGATTTAACT
TTGTAAAATTCTTCACATTAACAAACATCTATAGGACCTTTTGACTATATGTCAAGTGAT
TCAATAAATAGCTAAGAGCGTATACAAAGCTAAGAAGATAAATCTGTTTATGGAGATGGT
GATATGTCACCTAAGAGTTCTACGTATACTGATTCCTCATTTAAAAAGTCAAACATTAGT
TTCATAAATAGTGCAGCTCAGCAGCTAAAGCTACTACAATAAATGGATCAAACTAATTAA
GACTTGTTCTCCAATACTCCATTGACTAAACTAGAAAGAGTATAATTCATAGAAGGTTCA
GCTGAAAGTAAAAGGTTACTTGAGTAATAATTTAATGATGCATAATATTTTTATTAATAT
TAATAGCAAAATAATAAATCATTTGATAACAAAAATCAAAATAATCAAAATAAAAAAAAA
GATGTAAAGAGTAAAGCTAAAATATATACAAATGAAAATGTTAGCAGTAAAAATAAGTAA
ATTAGAAAATTTTAAAGCTTATTAAAGGTAGATGCTGATTTAGAGAAAGAATTCTTAAAA
TTAGCCTAGTGTGAATAATATCAAATAAAACCTGAAGATATTTAAAAATAAAATAATTTT
TAAAATTAAAAGCAATTAGAAATTTAGTAACAACCTCCTTCTCCAAATACTTAAAAAATG
AGTCTTTTTCAAAAGGATTTTGTTGAATCGTCTAAAAACATAGAAAGAAGTAGCAGAAAC
AAGGAAGAAAAAATCATGTTTTCACCTACAAAAAGTTCATAACATATTAATAGTAGTTAA
TAGAAAATAGATGTTTTGAATAAAACAGATAGTTTTAATCTATAAAAGCTTGTTGAAAAA
AAAAAATAAATGTTAGCTGCTTTTAGGAAGAGAAATTATAAGAATTTAAGCAACTAGTTT
CCTTTAAATTAAGAAGCAATTAAAGCTCCTTCAAACATATACTTTTAAATTCTTCAATCA
AAACCTGATAAATTCTCTCATTAAAGAAATCAAACATACTCAAATGATACAAATTCATTA
TTGTAAACTGCTAAGGTTGAAAATAATTTTCCTGTGTAAAATAAATTCCCTTAAAAATAT
ATTTAAGAAAATGAGAATTACTTTACAATGAAGAACAAATATCAAGCAAAAAAACATTAA
AAGTAATTACTATTAAATATATATATTATTTATAAATAATAAATATAAATTATATAAAAT
AGATCTCAATAAACTTAGGTTTCAGTAACTAGTACAAAAAATAATTTTAACAAATCAACA
AATGATGAAACATAGAAAGATTGTGTAAAGGACTAAAGAGTCAAAACTCAATCAAGTTAT
TTTTTATATAAAAAGTAAGAATAGCAAAGTAGTTATATCACAAATAGTTAGAGACTGTCT
TTATCTATTAAGTCTAATATGAATAAGACATAAAATATTTTTGAAAATTTAGAAAGAGCA
AGAAAACCAAAAATTGATAATTTTTTCAATTAAAAAAAATGA