Identifiers and Description

Gene Model Identifier

TTHERM_00245740

Standard Name

NRK2 (NIMA-Related Kinase )

Aliases

PreTt02469 | 21.m00300

Description

NIMA (Never In Mitosis) related kinase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF01163 ) RIO1 family
  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase
  • ( PF04394 ) Protein of unknown function, DUF536

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00245740

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00513.19.997093137033517e-262protein kinase domain-containi
ng protein (544 aa)
OxytrichaContig16193.0.g776.000667945664035e-116Protein kinase domain
DictyBaseDDB_G02708146.997794455893953e-54nek2 on chromosome: 1 position
4847143 to 4848761
Stentor CoeruleusSteCoe_348011.0377033238158346e-53
WormBaseWBGene000089561.9998745702418095e-48locus:nekl-3 status:Confirme
d UniProt:G5EFM9 protein_i
d:CAA92169.2
SGDYAR018C4.9986056260133516e-43KIN3 Nonessential serine/threo
nine protein kinase; possible
role in DNA damage response

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16611747: Wloga D, Camba A, Rogowski K, Manning G, Jerka-Dziadosz M, Gaertig J (2006) Members of the NIMA-related kinase family promote disassembly of cilia by multiple mechanisms. Molecular biology of the cell 17(6):2799-810

Sequences

>TTHERM_00245740(coding)
ATGTCCTTGAAAGATTTTGTGAATTTATAGAAGATAGGTGAGGGCTCTTACTCAAGTGTC
CATAAAGTAAGAAGGATCTCAGATAACTAAGAATACGCCCTCAAAAAGGTTAAATTATCT
GGTTTAAGCGAAAAAGAGAAAGATAACGCTCTTAATGAGATAAGAATATTAGCAAGTATA
GCTCATCCAAACATGATTGCATATAAGGATGCCTTTTTTGATGAATCTTCTCACTCACTT
TGCATTGTTATGGAGTTAGCCGTCAACGGTGATCTTTCTAAAAAAATTGATAGTGCAAAA
AAAAGAAATAGCTTTGTTCCAGAAGAAGAAATTTGGACAGTAGCGTTGCATATGTTAAGA
GGTTTGAAAGCTATGCACTCCAAAAAGATTCTTCACAGAGACCTCAAGTGTGCAAATGTC
TTTATTTCCAAGCAAGATGAATACAAAATTGGTGATCTCAATGTCTCAAAAGTCGCCAAA
AGAGGACTAGTATACACTTAAACTGGTACTCCTTATTACGCATCACCTGAAGTTTGGAGA
GATGAACCATATGACAGTTCAAGCGATATTTGGTCATTTGGATGCATTTTATACGAATTA
GCAGCTCTTAATCCACCATTTAGAGCTAAAGATATGGAAGGATTGTATAAAAAAGTATAG
AAAGGTATATTTGAGAGAATTCCATAAAGATATTCTAATGATTTGTAGAAGTTTATTGCA
TTATGCCTTTAGGTTAGTAGTGTATAACGTCCTTCTGTTACTTAGCTTTTAAACAATGTA
CTTCTTAAGCGTAATACCTAATTTTTAGCAGAATCTCCTGAAGAGTAATAAGATAAGGAA
AACACCCTTAGCCCAGAAGACCTTTTAAACACAATCAAAATGCCTAAAAACCCTCGTTAG
CTTAAGGAAAAGCTCCCAAAGCCTTAATATGATAAAGAGATATTAAATAATTCATATGAT
GGAGAAATACAACGCAAGGAGCGTAACCACAATAGGAATATGTCTGTAAAAATGAATAGG
ATATAATCTGTAACCAACCATAAATAGCATTAATACCTATAATAGTAATAGCAACTAATG
TTGGAGTAGGAAGGAAAAGATGTTGTTTTACCTTTAATTCCCAGATCATAATAATAAAAA
ATATTAGAACCTATAAGTAACAGCTAGTTACAGGCATAACAAAATAATAGCAATATTATA
GGTAGCTAAAATGATATTTATTCTAGAATAGGTAGCAACAGATATGAAAATTCTTCATCC
ATAGTTAGTGATTCCAGAAATTACTTGCAGGAAATACAGCCAAAAAAGCGAATTAATTAA
AATGGTTCAAGTGGTAACTACAATGAAGATTACTCCTAAAAATATAATAGATATGATTAA
CAACCAAGGTCAATAAACTCTCCAACTATATCTGTAATTTCTAAAAAGGATACAGGGTAT
TCAAATCCAGTGAACTCCATTAATCCACTAAGAAACAGAGTTAATTCTATAAATCAAATC
AATAGTTATGCAAGAATAGCTAATTTATATTAAAATTCTAAAAATCCCTATAACAACTAC
AGCGGAAATTCGATGCAGAGTGTTTCAATCGACTACAATCCTTAATATTCTCGTCCTGTT
TGGTGGGGTTGA


>TTHERM_00245740(protein)
MSLKDFVNLQKIGEGSYSSVHKVRRISDNQEYALKKVKLSGLSEKEKDNALNEIRILASI
AHPNMIAYKDAFFDESSHSLCIVMELAVNGDLSKKIDSAKKRNSFVPEEEIWTVALHMLR
GLKAMHSKKILHRDLKCANVFISKQDEYKIGDLNVSKVAKRGLVYTQTGTPYYASPEVWR
DEPYDSSSDIWSFGCILYELAALNPPFRAKDMEGLYKKVQKGIFERIPQRYSNDLQKFIA
LCLQVSSVQRPSVTQLLNNVLLKRNTQFLAESPEEQQDKENTLSPEDLLNTIKMPKNPRQ
LKEKLPKPQYDKEILNNSYDGEIQRKERNHNRNMSVKMNRIQSVTNHKQHQYLQQQQQLM
LEQEGKDVVLPLIPRSQQQKILEPISNSQLQAQQNNSNIIGSQNDIYSRIGSNRYENSSS
IVSDSRNYLQEIQPKKRINQNGSSGNYNEDYSQKYNRYDQQPRSINSPTISVISKKDTGY
SNPVNSINPLRNRVNSINQINSYARIANLYQNSKNPYNNYSGNSMQSVSIDYNPQYSRPV
WWG


>TTHERM_00245740(gene)
ATGTCCTTGAAAGATTTTGTGAATTTATAGAAGATAGGTGAGGGCTCTTACTCAAGTGTC
CATAAAGTAAGAAGGATCTCAGATAACTAAGAATACGCCCTCAAAAAGGTTAAATTATCT
GGTTTAAGCGAAAAAGAGAAAGATAACGCTCTTAATGAGATAAGAATATTAGCAAGTATA
GCTCATCCAAACATGATTGCATATAAGGATGCCTTTTTTGATGAATCTTCTCACTCACTT
TGCATTGTTATGGAGTTAGCCGTCAACGGTGATCTTTCTAAAAAAATTGATAGTGCAAAA
AAAAGAAATAGCTTTGTTCCAGAAGAAGAAATTTGGACAGTAGCGTTGCATATGTTAAGA
GGTTTGAAAGCTATGCACTCCAAAAAGATTCTTCACAGAGACCTCAAGTGTGCAAATGTC
TTTATTTCCAAGCAAGATGAATACAAAATTGGTGATCTCAATGTCTCAAAAGTCGCCAAA
AGAGGACTAGTATACACTTAAACTGGTACTCCTTATTACGCATCACCTGAAGTTTGGGTA
ATTTAGTTTAAAAAATAATTTATACAAATCATGATTTAAATATTTGAAGAGGATTGGTAT
GTTTTTAATTTTTATCAAGCCAATAACATTCAAAAAAAAAATGGAAATATATTAAGCAAA
TAAATGAAAGGTTATCTTACCAAATGAATGATGGTACATTTCATTTTACATCTTAGTGCA
ATAATTAGTAATAGTTTTGATAAATAGAATTAAAGAACAAGTTAACAAACAAACAACAAA
TTCCTATTGATTTATTAACTACTTTGTCAAAAATAACTCTTATTTAATCTTTGATTCTAT
TTTTTACGTTCCATTCAATTTGCTATTAAAAATAGAATTTTTAAATTTTAAGAGATTCTT
TAAGATATTATCTTAATTGCGTTTCTTTTTTCAGTCAATCTTTGATTTAATCGTTCATGA
ATGAAATGTTATATATTATTGCTGCCTTTATAGAATAACAAATACAAAAAAAATTATAAA
TTTTAACTCATTATCAAATCTAAAAGCTAATTAATTCCTTAATTTGTTTGGACTAAAGAG
AAGCAACGCACATATAAAAAAATTTATAATTTTAAAATCAAGCAAGATAAATTTTAAAGA
GTTTATTTTTGAGGGTAGCATAGATCAATTAATTCATAAGAAATTTTTAAATATACTGAA
TAGAAATTTAATCATAAATTAATTCTAGAATAAAAAAATCCTCTTATTTTTTATGATGAA
AAATAATTAAATATACAAATAAATTAATAACTATATTTTTTATTTTAGAGAGATGAACCA
TATGACAGTTCAAGCGATATTTGGTCATTTGGATGCATTTTATACGAATTAGCAGCTCTT
AATCCACCATTTAGAGCTAAAGATATGGAAGGATTGTATAAAAAAGTATAGAAAGGTATA
TTTGAGAGAATTCCATAAAGATATTCTAATGATTTGTAGAAGTTTATTGCATTATGCCTT
TAGGTTAGTAGTGTATAACGTCCTTCTGTTACTTAGCTTTTAAACAATGTACTTCTTAAG
CGTAATACCTAATTTTTAGCAGAATCTCCTGAAGAGTAATAAGATAAGGAAAACACCCTT
AGCCCAGAAGACCTTTTAAACACAATCAAAATGCCTAAAAACCCTCGTTAGCTTAAGGAA
AAGCTCCCAAAGCCTTAATATGATAAAGAGATATTAAATAATTCATATGATGGAGAAATA
CAACGCAAGGAGCGTAACCACAATAGGAATATGTCTGTAAAAATGAATAGGATATAATCT
GTAACCAACCATAAATAGCATTAATACCTATAATAGTAATAGCAACTAATGTTGGAGTAG
GAAGGAAAAGATGTTGTTTTACCTTTAATTCCCAGATCATAATAATAAAAAATATTAGAA
CCTATAAGTAACAGCTAGTTACAGGCATAACAAAATAATAGCAATATTATAGGTAGCTAA
AATGATATTTATTCTAGAATAGGTAGCAACAGATATGAAAATTCTTCATCCATAGTTAGT
GATTCCAGAAATTACTTGCAGGAAATACAGCCAAAAAAGCGAATTAATTAAAATGGTTCA
AGTGGTAACTACAATGAAGATTACTCCTAAAAATATAATAGATATGATTAACAACCAAGG
TCAATAAACTCTCCAACTATATCTGTAATTTCTAAAAAGGATACAGGGTATTCAAATCCA
GTGAACTCCATTAATCCACTAAGAAACAGAGTTAATTCTATAAATCAAATCAATAGTTAT
GCAAGAATAGCTAATTTATATTAAAATTCTAAAAATCCCTATAACAACTACAGCGGAAAT
TCGATGCAGAGTGTTTCAATCGACTACAATCCTTAATATTCTCGTCCTGTTTGGTGGGGT
TGA