Identifiers and Description

Gene Model Identifier

TTHERM_00467740

Standard Name

NRK18 (NIMA-Related Kinase)

Aliases

PreTt18676 | 55.m00231 | 3710.m00080

Description

NIMA-Related Kinase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase
  • ( PF06476 ) Protein of unknown function (DUF1090)
  • ( PF07122 ) Variable length PCR target protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00467740

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15719.19.997093137033517e-262protein kinase domain-containi
ng protein (1132 aa)
OxytrichaContig22240.0.g431.9992336839414155e-150Protein kinase domain
DictyBaseDDB_G02708145.000940857796793e-119nek2 on chromosome: 1 position
4847143 to 4848761
SGDYAR018C1.000371485572848e-69KIN3 Nonessential serine/threo
nine protein kinase; possible
role in DNA damage response
Stentor CoeruleusSteCoe_135661.733141042341547e-58
WormBaseWBGene000089567.999866353200662e-52locus:nekl-3 status:Confirme
d UniProt:G5EFM9 protein_i
d:CAA92169.2

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16611747: Wloga D, Camba A, Rogowski K, Manning G, Jerka-Dziadosz M, Gaertig J (2006) Members of the NIMA-related kinase family promote disassembly of cilia by multiple mechanisms. Molecular biology of the cell 17(6):2799-810

Sequences

>TTHERM_00467740(coding)
ATGGATAACTACGAAATATTAGGCTAAATCGGAAAGGGTAGCTTTGGTTTAGTATAAAAG
ATTAAAAGGAAATCCGACGGGAAAGTACTTGTTTGGAAAGAAATGAATTATGGAAGAATG
AGTGAAAGAGAAAAGCAATAGCTTGTAGCAGAAGTAAATATAATACGAGAGCTTAAACAC
CCAAATATAGTGAGATATTATGACAGAATCATTGAGAAAAAAGACACTAAAATTTATATT
ATTATGGAATACTGCGAGGGAGGAGATGTAGGCACTCTCTTAAAGAAATGCAAGAAAGAA
AAAGATTATATTGCTGAAGATGTTATTTGGAAAATATTTACTTAAATAATTCTTGCACTC
AATGAATGTCACAACAGACCTTAGGGAAAAATATTACACAGAGATCTTAAACCTGCAAAT
ATATTTCTTGACGCTTAAAATAATATTAAACTAGGCGATTTTGGTTTAAGTAGAGTCATG
GGAGAATAATCTGAATTTGCAGATACACATGTAGGAACACCATACTACATGTCACCTGAG
TAAATATAAGAGAAAAAATATAATGAAAAGAGTGATATTTGGAGTGCTGGTTGTCTTTTA
TATGAAATGGCTGCTTTAAAGCCTCCCTTTGAAGCTACTAATCATCTTTCACTTGCTATA
AAAATTAAAAGTGGTAAATTTGAAAGACTACCTTTAAGATACAGTGAAGAATTGTAAAAA
TTAATTGAAAGTATGGTTCATATAGACCCTGAAAAGAGACCTTCTGTTTAAAATATTCTC
GAATTGCCATAAATAAACCTTCGTTTGAAGGAAAGAAAGTTGAGAGAAAAGCACTCTTAA
ATAAAATTAAAAGAAGACGAGCTAAAAAAGCGCGAGGAACAACTGCAAGAAAGAATTGAT
TAAATAGAAAAAAAGGAAAAAGACTTAACTGCCCAAGAATAAACTTTAAAGGATTTGGAG
GAATAAGTAAAATAAATTGAAGCTCAGTTAAACATAAGGTCATCTCAAAATTCACTTCAA
TAATCTGAAGAAGATATTTTTTAAAGATAAGATAAATAGACAAATAATAATAACAATGCA
GGAGTATTACCTTAAAAAAGTGCAAGAGGAGAATATTAATTGCTAAGTTAAAATTTAAAC
AGTTTTGGTAAAGACCTCATGATGCTAAATAAAGGCAGCGTTGAAAACAATAGTAGTGGC
AGCTCAAGTAAAAATAGCACTGCTACAGCATCAAATAATACTTTTGAGATATTTAAAAAA
GAAAAAGAAAATATGATAAACAATGGAAGCAATATCTAAAGCAATTTATAAAGTATAGAG
AATTACAGAAAAGAAAAGGAAATTCAAAAATAGCTTTAATCTTACTCAAGCAACAAATAT
CCAATCTTTTAAAAATCTAATTCATCTATTGTTTCCTAGAGTTTAACGGATTAATAAATG
CTATTGCAACAATAAAGCTCTTAGGATACAACTTCATCTTAAGTAGTTTAGCAATAATCT
AGTGAAAATAATTAATCTAATTTGAAATTAAGGGGTAATATTGCTGATACCTAGTAAACA
TAAAGCAGCTGTTCTTCTAACTCCAGCAACAATGATGCTAATGCTAGTAACCCTATAACA
GCAAACACTAAAGACAAAAATTATACTCTGTACTAGAGAAGAGAGCAAGAAGCTTTTTAA
AAAACTCCTAACAATAACAGCAATTTACACTAAAATTATCATACTTTGAATAGATAAGGG
GAAATTGAAAGTGTAACTAAAAAACATACTTCTTATTCAAAAGACCATTAATACAAGTCT
GTGGATCATTTCACATCTATTTAAAATAACAACAACTCTAGCTCAAAAAAAGATGAGAGT
ACTGCCTTTAGTACTACTTGTAAGTAAATACCTTAGTCAGCATCATAAAATTAGAATATT
GCAAACCAAAGTAGTAATAAATCTTCTCATAAAAGCAGCAGTGAAAATCTCCCTAAAAAG
AGTACTGTTGCTTAAATTTCTTCTACAAATAACTAAAATTAAATTGATAATTAAAACTAA
GAAAATTCTTCTGCTGCTTCTAATAATAACAATAATAATAATAATACAGGAATGTCTGCA
TTTGAAAGATACAAAGCTTCCATTTTATAGCAGTAACAATAGTAATAAAATTAAAATAAT
AATGGTTATTAAAATAAATATGCATAAATTAAATCTAAAGTGCGTTAAGCAAGTTAAGAT
TCCATGGATGATAATGAATAATAAACTATGAACAATAATTACACTTCAAAGCTTCATACA
TAATAACCCATTTCAAGTAAATTAAGAGCACAGACATCAATCGATTCAGTTTCTGTAAAA
TAAAACCAAGATAATAAAAACTACTTGCTTAATTATAAAAAGGATGCTCCTTCTGGTAGC
ACAGCATCAGCTGCAACAATTACTAGAAGATCAGCAAACACTACAATAGATTCAGTAAAG
TATTCTCAAATTAATAATTCTTCAAATATGTAAGGACCTACTAATAATAATAATTAAAAT
GCCTCTTATGAGATATATAAATAAGCAAACATAAAAAGAACAGATAGTTATAAAGAAAAC
ACTTTCAAAAATATAATGTAATAAAATAATTTCATCAATAAGCAATAAGAAGCTGCAACT
CAATCTTCTTCTAATAATAATTAACAAATACATTCTTCAACAAATTTAGCTTAAAATTAA
AAGAATTTTTAGAAAAACAGATCATCATTAGAGCCTAAAAATAGATTCCACTCTTAGCAT
AGCACAACTTCATCATCATCAACAACAACAGCATAAACTGCTATACAATCTACACAATAA
CCATAGTAGTCTTCATCGTAGGTTGCTTTAAACTCAAATAAACCTCCAATTACTATGATG
AATAACAATGGAGCATTAAATGGGAATAGTAATAATAACGAAGATGCCTTACTTAATTTC
AAAACGCTCCCTAATACCGAATTTCAATATGATTCCAATAATGTTAATAAAATGTAAATA
AAGAAGAAAAACAATAACAGCTTCACAACAACATCATAAAATATAAGCAACACTTATTTA
AATAGTAACAATAATTATATAAATAATTAACCACGTTCTACTACTAATAGTAACACAATA
GGTAATAACTCAGCTCGTATAAATAATACAGAATAAAGTATTGAAAGAAAAAAAGAATTT
CCTCGTCCTAGAAATAATTATCTGTTACCTTAATCCAGATAAACTTTAAACAGTAATCAA
AATCCAGATGCTAATATAAAGAATTATTTCTCAGAATAACCAAGCAACCTTATGACTGTG
CAGACAGACTAATTGTATAATAAATATAATTTAAGAAAGATAGGCGATAACATTATTTCT
CCATCAGTATAGCACGTTTCATCAAACTAATATAGAACTGCTACTTAATACTGA


>TTHERM_00467740(protein)
MDNYEILGQIGKGSFGLVQKIKRKSDGKVLVWKEMNYGRMSEREKQQLVAEVNIIRELKH
PNIVRYYDRIIEKKDTKIYIIMEYCEGGDVGTLLKKCKKEKDYIAEDVIWKIFTQIILAL
NECHNRPQGKILHRDLKPANIFLDAQNNIKLGDFGLSRVMGEQSEFADTHVGTPYYMSPE
QIQEKKYNEKSDIWSAGCLLYEMAALKPPFEATNHLSLAIKIKSGKFERLPLRYSEELQK
LIESMVHIDPEKRPSVQNILELPQINLRLKERKLREKHSQIKLKEDELKKREEQLQERID
QIEKKEKDLTAQEQTLKDLEEQVKQIEAQLNIRSSQNSLQQSEEDIFQRQDKQTNNNNNA
GVLPQKSARGEYQLLSQNLNSFGKDLMMLNKGSVENNSSGSSSKNSTATASNNTFEIFKK
EKENMINNGSNIQSNLQSIENYRKEKEIQKQLQSYSSNKYPIFQKSNSSIVSQSLTDQQM
LLQQQSSQDTTSSQVVQQQSSENNQSNLKLRGNIADTQQTQSSCSSNSSNNDANASNPIT
ANTKDKNYTLYQRREQEAFQKTPNNNSNLHQNYHTLNRQGEIESVTKKHTSYSKDHQYKS
VDHFTSIQNNNNSSSKKDESTAFSTTCKQIPQSASQNQNIANQSSNKSSHKSSSENLPKK
STVAQISSTNNQNQIDNQNQENSSAASNNNNNNNNTGMSAFERYKASILQQQQQQQNQNN
NGYQNKYAQIKSKVRQASQDSMDDNEQQTMNNNYTSKLHTQQPISSKLRAQTSIDSVSVK
QNQDNKNYLLNYKKDAPSGSTASAATITRRSANTTIDSVKYSQINNSSNMQGPTNNNNQN
ASYEIYKQANIKRTDSYKENTFKNIMQQNNFINKQQEAATQSSSNNNQQIHSSTNLAQNQ
KNFQKNRSSLEPKNRFHSQHSTTSSSSTTTAQTAIQSTQQPQQSSSQVALNSNKPPITMM
NNNGALNGNSNNNEDALLNFKTLPNTEFQYDSNNVNKMQIKKKNNNSFTTTSQNISNTYL
NSNNNYINNQPRSTTNSNTIGNNSARINNTEQSIERKKEFPRPRNNYLLPQSRQTLNSNQ
NPDANIKNYFSEQPSNLMTVQTDQLYNKYNLRKIGDNIISPSVQHVSSNQYRTATQY


>TTHERM_00467740(gene)
ATGGATAACTACGAAATATTAGGCTAAATCGGAAAGGGTAGCTTTGGTTTAGTATAAAAG
ATTAAAAGGAAATCCGACGGGAAAGTACTTGTTTGGAAAGAAATGAATTATGGAAGAATG
AGTGAAAGAGAAAAGCAATAGCTTGTAGCAGAAGTAAATATAATACGAGAGCTTAAACAC
CCAAATATAGTGAGATATTATGACAGGTATATTTATTAAAGAGTTTTACACTATTGCATT
TAAAAAATAAGAGAATGAATTTGAATTAAATTCCTGATTTAAGTCTAAAATTTAATCTTT
TATGAGAATAAACTATGCATTTGTCAAAGTTTATCAATTTGGCTTTATTTAAATGTAATG
CCCACATTTAAATTTGAGCTATGCATCAGGCAGGCAAATCAATATCGTATTTTCTATTTT
TTTGATATTGCCTTTTAAATGAAAAAGAGAGTATTAAATCAAAATAAATGTTTTTCAAGA
TATTAATTAAGATGCAATTATTAAATTTTAAAAATCTTTGGCTGATTATTTGATTTCAAA
TTATAAATCACAACCTTTTTACTTATTTTTCCTTTGCATTTTCAAATAATCTCTTCTCTT
TAAACAACTTCAAATTTATACGGAATGTTGTGGTAACGAGCGAGAAAATTAATTCAAAAT
CAGTTTTTAGTCTTTGCCTATTTTACATCAACATGCATGAGAATTTGCTTATTTATTTAT
TTGTTTTAACGAATTTAAAATATGTTTGTTTGAACAAATTATTCAATTTGAAAAAATAAA
TAAAAAAATATTAAAGCAAAATATTTTAAATCTTCTTTGGCTATTTGCATTTATTTAAAT
AATTATTATAAAATTTATAGAATCATTGAGAAAAAAGACACTAAAATTTATATTATTATG
GAATACTGCGAGGGAGGAGATGTAGGCACTCTCTTAAAGAAATGCAAGAAAGAAAAAGAT
TATATTGCTGAAGATGTTATTTGGAAAATATTTACTTAAATAATTCTTGCACTCAATGAA
TGTCACAACAGACCTTAGGGAAAAATATTACACAGAGATCTTAAACCTGCAAATATATTT
CTTGACGCTTAAAATAATATTAAACTAGGCGATTTTGGTTTAAGTAGAGTCATGGGAGAA
TAATCTGAATTTGCAGATACACATGTAGGAACACCATACTACATGTCACCTGAGTAAATA
TAAGAGAAAAAATATAATGAAAAGAGTGATATTTGGAGTGCTGGTTGTCTTTTATATGAA
ATGGCTGCTTTAAAGCCTCCCTTTGAAGCTACTAATCATCTTTCACTTGCTATAAAAATT
AAAAGTGGTAAATTTGAAAGACTACCTTTAAGATACAGTGAAGAATTGTAAAAATTAATT
GAAAGTATGGTTCATATAGACCCTGAAAAGAGACCTTCTGTTTAAAATATTCTCGAATTG
CCATAAATAAACCTTCGTTTGAAGGAAAGAAAGTTGAGAGAAAAGCACTCTTAAATAAAA
TTAAAAGAAGACGAGCTAAAAAAGCGCGAGGAACAACTGCAAGAAAGAATTGATTAAATA
GAAAAAAAGGAAAAAGACTTAACTGCCCAAGAATAAACTTTAAAGGATTTGGAGGAATAA
GTAAAATAAATTGAAGCTCAGTTAAACATAAGGTCATCTCAAAATTCACTTCAATAATCT
GAAGAAGATATTTTTTAAAGATAAGATAAATAGACAAATAATAATAACAATGCAGGAGTA
TTACCTTAAAAAAGTGCAAGAGGAGAATATTAATTGCTAAGTTAAAATTTAAACAGTTTT
GGTAAAGACCTCATGATGCTAAATAAAGGCAGCGTTGAAAACAATAGTAGTGGCAGCTCA
AGTAAAAATAGCACTGCTACAGCATCAAATAATACTTTTGAGATATTTAAAAAAGAAAAA
GAAAATATGATAAACAATGGAAGCAATATCTAAAGCAATTTATAAAGTATAGAGAATTAC
AGAAAAGAAAAGGAAATTCAAAAATAGCTTTAATCTTACTCAAGCAACAAATATCCAATC
TTTTAAAAATCTAATTCATCTATTGTTTCCTAGAGTTTAACGGATTAATAAATGCTATTG
CAACAATAAAGCTCTTAGGATACAACTTCATCTTAAGTAGTTTAGCAATAATCTAGTGAA
AATAATTAATCTAATTTGAAATTAAGGGGTAATATTGCTGATACCTAGTAAACATAAAGC
AGCTGTTCTTCTAACTCCAGCAACAATGATGCTAATGCTAGTAACCCTATAACAGCAAAC
ACTAAAGACAAAAATTATACTCTGTACTAGAGAAGAGAGCAAGAAGCTTTTTAAAAAACT
CCTAACAATAACAGCAATTTACACTAAAATTATCATACTTTGAATAGATAAGGGGAAATT
GAAAGTGTAACTAAAAAACATACTTCTTATTCAAAAGACCATTAATACAAGTCTGTGGAT
CATTTCACATCTATTTAAAATAACAACAACTCTAGCTCAAAAAAAGATGAGAGTACTGCC
TTTAGTACTACTTGTAAGTAAATACCTTAGTCAGCATCATAAAATTAGAATATTGCAAAC
CAAAGTAGTAATAAATCTTCTCATAAAAGCAGCAGTGAAAATCTCCCTAAAAAGAGTACT
GTTGCTTAAATTTCTTCTACAAATAACTAAAATTAAATTGATAATTAAAACTAAGAAAAT
TCTTCTGCTGCTTCTAATAATAACAATAATAATAATAATACAGGAATGTCTGCATTTGAA
AGATACAAAGCTTCCATTTTATAGCAGTAACAATAGTAATAAAATTAAAATAATAATGGT
TATTAAAATAAATATGCATAAATTAAATCTAAAGTGCGTTAAGCAAGTTAAGATTCCATG
GATGATAATGAATAATAAACTATGAACAATAATTACACTTCAAAGCTTCATACATAATAA
CCCATTTCAAGTAAATTAAGAGCACAGACATCAATCGATTCAGTTTCTGTAAAATAAAAC
CAAGATAATAAAAACTACTTGCTTAATTATAAAAAGGATGCTCCTTCTGGTAGCACAGCA
TCAGCTGCAACAATTACTAGAAGATCAGCAAACACTACAATAGATTCAGTAAAGTATTCT
CAAATTAATAATTCTTCAAATATGTAAGGACCTACTAATAATAATAATTAAAATGCCTCT
TATGAGATATATAAATAAGCAAACATAAAAAGAACAGATAGTTATAAAGAAAACACTTTC
AAAAATATAATGTAATAAAATAATTTCATCAATAAGCAATAAGAAGCTGCAACTCAATCT
TCTTCTAATAATAATTAACAAATACATTCTTCAACAAATTTAGCTTAAAATTAAAAGAAT
TTTTAGAAAAACAGATCATCATTAGAGCCTAAAAATAGATTCCACTCTTAGCATAGCACA
ACTTCATCATCATCAACAACAACAGCATAAACTGCTATACAATCTACACAATAACCATAG
TAGTCTTCATCGTAGGTTGCTTTAAACTCAAATAAACCTCCAATTACTATGATGAATAAC
AATGGAGCATTAAATGGGAATAGTAATAATAACGAAGATGCCTTACTTAATTTCAAAACG
CTCCCTAATACCGAATTTCAATATGATTCCAATAATGTTAATAAAATGTAAATAAAGAAG
AAAAACAATAACAGCTTCACAACAACATCATAAAATATAAGCAACACTTATTTAAATAGT
AACAATAATTATATAAATAATTAACCACGTTCTACTACTAATAGTAACACAATAGGTAAT
AACTCAGCTCGTATAAATAATACAGAATAAAGTATTGAAAGAAAAAAAGAATTTCCTCGT
CCTAGAAATAATTATCTGTTACCTTAATCCAGATAAACTTTAAACAGTAATCAAAATCCA
GATGCTAATATAAAGAATTATTTCTCAGAATAACCAAGCAACCTTATGACTGTGCAGACA
GACTAATTGTATAATAAATATAATTTAAGAAAGATAGGCGATAACATTATTTCTCCATCA
GTATAGCACGTTTCATCAAACTAATATAGAACTGCTACTTAATACTGA