Identifiers and Description

Gene Model Identifier

TTHERM_00216171

Standard Name

NRK17 (NIMA-Reated Kinase)

Aliases

3701.m01481

Description

Serine/threonine-protein kinase, putative

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00216171

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06585.19.997093137033517e-262hypothetical protein (1120 aa)
OxytrichaContig18762.0.g764.9988663627895604e-120Protein kinase domain
DictyBaseDDB_G02752414.001287313050914e-66nek3 on chromosome: 2 position
4983790 to 4987279
WormBaseWBGene000214617.996547841088611e-53locus:nekl-1 status:Partiall
y_confirmed UniProt:Q6AW07
protein_id:CCD69902.1
Stentor CoeruleusSteCoe_240131.5400882849875202e-51
SGDYAR018C4.001118334825066e-42KIN3 Nonessential serine/threo
nine protein kinase; possible
role in DNA damage response

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00216171(protein)
MLNNGSSSTLKDFDTLGKLGQGSFGVVYKVKRVVDGNVYVMKQINISKMNSRMKQDAINE
VHILSKLNNPYVVKYYDSFVDKNLLCIVMEYCDSGDLSSFIKSQLGRPLQEMKIWKYFIM
SCMGLDYIHRKKILHRDIKAMNIFLNKDDSLRIGDLGVAKVLSDQGNFASTMVGTPFYLS
PEMCEEKPYNEKSDIWSLGCVLYELCTYRHPFEAQNQGALVLRIIRGKYNPIPTSYSKDL
VSMVDMCLCKDYKKRPNARDILQTQIVLGKASQLGIELDYTKVKQKELNYQQKKEGSVSV
PTTVPSTPSSNKNLIDKQREKNNALLNPNNQNKPISHSPSSHNVQAAAQQKAKDDLIKKM
QQDERDLNKKVEQKLIQQNLQQIQNNDKKYKDRIQELYKKEEQFKLLQKQELERQKNTEQ
VLQMQKKREEQMKKDEERKLLEKKKKEAEKKKEEEELRKKKELEKQKQEKAAAAALSQQQ
QLVKEKEDQIKNEFKIRQNGFDPRVNQVSQQQQVSKVERTSPKQSDSKKQLFGNQMPNNF
NKQVQQVQQQLPSQFGYQKQQVEKKKEIISERKESIKPKEDDRKNIQRIRKGAPTGLGNI
AKNPLSYGYKDVRQSKDGRPSDFSYEQDQDRQEVYNLPDNVHKQRNAPKSAQPYKPTVND
LRNIANSGFEENTSKISSQRGSVMSNQTSKSQNDQRIVEQKRLNRPEQGKLPSVESFDSS
FEDSPNKHISVQSASSLQKQTQEDKDMQNAVLNQDLNRPHTGQLKEKLHYNKPFVDKEIT
EKYEKELQKQNKQNIQQIVNDSFIDKEFCSSSDDDKKSKQNIKKSDKKQNLENTQFEFIP
VPKAKELKDWNNKIQLDNSEQQQQCSEEEEDDNKLGDEYFKSQTINRGQLDLPDDMGGAD
EEDDNNQDYDEEEEEEQKEEEDDQYYQEEDDEDDQDQSENNQDDDQDIQSIPDQNDWQKD
EEDDEYEDDQENEYEQQAAEQYSKNKYEQDEYEEQSYEQSTSTDVSSQNKRDIKQKIQQK
LQARLKRQNELQTLLDIKVSECHKVLGEQKFNVILQFFKDKLNCEKELTDEDQDEIDQMM
QENMKNITNNQVIQNFYKILHLDIELEKCKTDVRSIQENIQQL


>TTHERM_00216171(coding)
ATGCTTAATAATGGATCTTCTTCTACCCTAAAAGATTTTGATACATTAGGAAAATTAGGA
TAGGGTAGTTTTGGTGTAGTGTATAAAGTAAAAAGAGTTGTAGATGGAAATGTGTATGTC
ATGAAGTAAATAAACATCAGTAAAATGAATAGCAGAATGAAACAGGATGCAATTAATGAG
GTTCACATTCTCTCAAAGTTGAATAACCCATATGTAGTTAAATATTATGATTCCTTCGTT
GATAAAAATTTGTTATGCATTGTAATGGAATATTGCGATAGCGGTGATCTATCTTCTTTT
ATTAAAAGCTAACTAGGAAGGCCATTATAAGAAATGAAAATATGGAAGTATTTCATTATG
TCTTGTATGGGGCTAGATTATATTCATAGGAAAAAAATATTGCACCGTGATATAAAGGCA
ATGAATATTTTTTTGAATAAAGATGATAGTTTACGTATTGGTGATTTGGGAGTTGCAAAA
GTATTGTCTGATCAAGGAAATTTTGCCAGTACTATGGTAGGAACACCTTTTTATTTATCA
CCAGAAATGTGTGAAGAAAAACCATACAATGAAAAATCTGATATTTGGAGTTTAGGATGC
GTTTTGTATGAATTGTGCACTTATCGTCACCCTTTTGAAGCACAGAATTAAGGAGCTTTA
GTTTTAAGAATCATAAGAGGCAAATATAATCCAATACCTACAAGTTATTCGAAAGATTTA
GTAAGCATGGTTGATATGTGTTTATGTAAAGATTATAAGAAAAGACCAAACGCAAGAGAT
ATTTTGTAAACTTAAATTGTATTAGGAAAAGCAAGCTAATTAGGGATTGAGCTAGACTAC
ACAAAAGTGAAATAAAAAGAATTAAATTATTAATAGAAAAAAGAAGGATCAGTAAGCGTG
CCTACTACAGTACCTTCAACTCCTTCATCAAATAAAAATCTTATAGATAAATAAAGAGAA
AAAAATAATGCTCTCCTCAATCCAAATAATCAAAATAAACCAATAAGCCACAGCCCTTCC
TCTCATAATGTTTAAGCTGCTGCATAATAAAAAGCCAAAGATGATTTAATAAAAAAAATG
CAATAAGATGAAAGGGATTTAAATAAAAAAGTAGAACAAAAACTAATTTAATAGAATTTA
TAACAAATATAAAACAATGATAAGAAGTATAAAGACAGAATCTAAGAATTATATAAAAAG
GAGGAATAATTCAAACTGTTACAAAAATAAGAACTAGAAAGATAAAAAAATACAGAGTAA
GTTCTCTAGATGTAAAAAAAGAGAGAAGAGTAAATGAAAAAAGATGAAGAAAGAAAATTA
TTAGAAAAAAAGAAAAAAGAGGCTGAAAAGAAAAAAGAGGAAGAAGAGTTAAGAAAAAAA
AAAGAACTCGAAAAGTAGAAATAGGAAAAGGCAGCTGCAGCAGCTTTGTCTCAGCAATAA
TAATTAGTAAAAGAAAAGGAAGACTAAATCAAAAACGAATTTAAAATTAGATAAAATGGA
TTTGATCCTAGAGTAAATCAAGTTTCTTAATAGTAGCAAGTAAGTAAGGTTGAAAGAACT
TCACCAAAGCAATCAGATAGCAAAAAGTAGCTGTTTGGAAATTAAATGCCTAACAATTTC
AATAAATAGGTATAATAAGTTCAACAACAGCTTCCTTCTCAATTTGGTTACCAAAAACAA
TAAGTTGAAAAGAAAAAAGAAATCATTTCTGAAAGAAAAGAGTCTATCAAACCAAAAGAA
GACGATAGAAAGAATATTTAAAGAATTAGAAAAGGAGCTCCTACTGGTCTTGGAAATATT
GCCAAAAACCCTTTAAGCTATGGGTATAAAGATGTCAGACAATCAAAGGATGGAAGACCT
TCAGATTTCAGTTATGAATAAGATTAAGACAGACAAGAAGTTTATAACTTACCTGATAAT
GTCCACAAGTAAAGAAATGCACCTAAATCAGCACAACCATACAAGCCAACTGTAAATGAT
CTTAGAAATATTGCAAACTCAGGATTTGAAGAAAATACCTCTAAAATTTCTTCTCAAAGA
GGATCAGTTATGTCTAACTAGACATCAAAATCATAAAATGACTAAAGAATCGTTGAGCAA
AAGAGACTTAATAGACCAGAATAAGGAAAATTACCATCAGTTGAAAGCTTTGATAGTTCT
TTTGAAGATAGTCCTAATAAGCATATTAGCGTACAGAGCGCTAGCAGTCTTCAAAAATAA
ACATAAGAAGATAAGGATATGTAAAATGCTGTTTTAAATTAAGATTTAAATAGACCTCAC
ACAGGTTAGTTAAAAGAAAAGCTGCACTATAATAAACCTTTTGTGGATAAAGAAATTACG
GAAAAATATGAAAAAGAGTTACAAAAACAAAATAAATAAAATATCTAATAAATTGTAAAT
GATAGCTTTATTGATAAGGAGTTTTGTTCCTCTTCAGACGATGATAAAAAGAGTAAATAA
AATATTAAAAAATCAGATAAAAAATAAAATTTGGAAAACACATAATTCGAATTTATTCCT
GTCCCTAAAGCTAAAGAATTAAAAGATTGGAATAATAAAATTTAATTAGATAATAGTGAA
CAATAATAATAATGCTCTGAAGAAGAAGAAGATGATAATAAGCTTGGAGATGAATATTTT
AAAAGCCAAACTATTAATCGTGGCTAGTTGGATTTACCTGATGATATGGGTGGAGCTGAT
GAAGAAGATGATAATAATTAAGATTATGATGAGGAAGAAGAAGAAGAATAAAAGGAGGAA
GAAGATGATTAATATTATTAAGAAGAAGATGATGAGGATGACTAAGATTAAAGTGAAAAT
AACTAAGATGACGATTAAGATATTTAATCTATTCCAGATTAAAATGATTGGTAAAAAGAT
GAGGAAGATGATGAGTATGAAGATGACTAAGAAAACGAATATGAATAGTAAGCTGCAGAG
TAATATAGTAAAAACAAGTATGAATAGGATGAATATGAAGAATAATCTTACGAATAATCT
ACTTCAACAGATGTTTCCTCATAAAATAAAAGAGATATTAAGCAGAAAATTTAGTAAAAG
CTTTAAGCAAGACTAAAAAGACAAAATGAACTTTAGACTCTTTTAGATATAAAAGTTTCA
GAATGCCATAAAGTTCTTGGTGAATAAAAGTTTAATGTGATTTTGCAGTTCTTTAAAGAT
AAATTAAATTGTGAAAAAGAATTAACAGACGAAGATCAAGACGAAATAGATTAAATGATG
CAAGAAAATATGAAAAATATTACTAATAATCAAGTAATTCAAAATTTCTACAAAATTTTG
CATTTAGATATTGAGTTAGAAAAATGTAAAACCGATGTTAGAAGTATTTAAGAAAATATA
CAATAACTTTGA


>TTHERM_00216171(gene)
ATGCTTAATAATGGATCTTCTTCTACCCTAAAAGATTTTGATACATTAGGAAAATTAGGA
TAGGGTAGTTTTGGTGTAGTGTATAAAGTAAAAAGAGTTGTAGATGGAAATGTGTATGTC
ATGAAGTAAATAAACATCAGTAAAATGAATAGCAGAATGAAACAGGATGCAATTAATGAG
GTTCACATTCTCTCAAAGTTGAATAACCCATATGTAGTTAAATATTATGATTCCTTCGTT
GATAAAAATTTGTTATGCATTGTAATGGAATATTGCGATAGCGGTGATCTATCTTCTTTT
ATTAAAAGCTAACTAGGAAGGCCATTATAAGAAATGAAAATATGGAAGTATTTCATTATG
TCTTGTATGGGGCTAGATTATATTCATAGGAAAAAAATATTGCACCGTGATATAAAGGCA
ATGAATATTTTTTTGAATAAAGATGATAGTTTACGTATTGGTGATTTGGGAGTTGCAAAA
GTATTGTCTGATCAAGGAAATTTTGCCAGTACTATGGTAGGAACACCTTTTTATTTATCA
CCAGAAATGTGTGAAGAAAAACCATACAATGAAAAATCTGATATTTGGAGTTTAGGATGC
GTTTTGTATGAATTGTGCACTTATCGTCACCCTTTTGAAGCACAGAATTAAGGAGCTTTA
GTTTTAAGAATCATAAGAGGCAAATATAATCCAATACCTACAAGTTATTCGAAAGATTTA
GTAAGCATGGTTGATATGTGTTTATGTAAAGATTATAAGAAAAGACCAAACGCAAGAGAT
ATTTTGTAAACTTAAAGTAATTATTCCATTTTATTTGTTAAAAGCATAAATTATATATCT
GTATTATAAAAATTAAACCAGTTGTATTAGGAAAAGCAAGCTAATTAGGGATTGAGCTAG
ACTACACAAAAGTGAAATAAAAAGAATTAAATTATTAATAGAAAAAAGAAGGATCAGTAA
GCGTGCCTACTACAGTACCTTCAACTCCTTCATCAAATAAAAGTAAGAAATAAAAATTTT
GATTACTTTTTATGTTCTCATTAAGCTATTATATAATGTTTAATTTTATTTTTAGATCTT
ATAGATAAATAAAGAGAAAAAAATAATGCTCTCCTCAATCCAAATAATCAAAATAAACCA
ATAAGCCACAGCCCTTCCTCTCATAATGTTTAAGCTGCTGCATAATAAAAAGCCAAAGAT
GATTTAATAAAAAAAATGCAATAAGATGAAAGGGATTTAAATAAAAAAGTAGAACAAAAA
CTAATTTAATAGAATTTATAACAAATATAAAACAATGATAAGAAGTATAAAGACAGAATC
TAAGAATTATATAAAAAGGAGGAATAATTCAAACTGTTACAAAAATAAGAACTAGAAAGA
TAAAAAAATACAGAGTAAGTTCTCTAGATGTAAAAAAAGAGAGAAGAGTAAATGAAAAAA
GATGAAGAAAGAAAATTATTAGAAAAAAAGAAAAAAGAGGCTGAAAAGAAAAAAGAGGAA
GAAGAGTTAAGAAAAAAAAAAGAACTCGAAAAGTAGAAATAGGAAAAGGCAGCTGCAGCA
GCTTTGTCTCAGCAATAATAATTAGTAAAAGAAAAGGAAGACTAAATCAAAAACGAATTT
AAAATTAGATAAAATGGATTTGATCCTAGAGTAAATCAAGTTTCTTAATAGTAGCAAGTA
AGTAAGGTTGAAAGAACTTCACCAAAGCAATCAGATAGCAAAAAGTAGCTGTTTGGAAAT
TAAATGCCTAACAATTTCAATAAATAGGTATAATAAGTTCAACAACAGCTTCCTTCTCAA
TTTGGTTACCAAAAAGTATGTATTTTAAAATTGTAAAAATAAATAATTTTTTTATATGCT
ATTTTAAATTAAATAGCAATAAGTTGAAAAGAAAAAAGAAATCATTTCTGAAAGAAAAGA
GTCTATCAAACCAAAAGAAGACGATAGAAAGAATATTTAAAGAATTAGAAAAGGAGCTCC
TACTGGTCTTGGAAATATTGCCAAAAACCCTTTAAGCTATGGGTATAAAGTAAGATATAC
TATGAAAGAACAATTTAAAAAAAAATAATTATTTTTAAATAGGATGTCAGACAATCAAAG
GATGGAAGACCTTCAGATTTCAGTATAAAACAATAAAATTTTGCTAAAAATCAAATACTA
ATTTAGTAATTAATTAATTAAAAGGTTATGAATAAGATTAAGACAGACAAGAAGTTTATA
ACTTACCTGATAATGTCCACAAGTAAAGAAATGCACCTAAATCAGCACAACCATACAAGC
CAACTGTAAATGATCTTAGAAATATTGCAAACTCAGGATTTGAAGAAAATACCTCTAAAA
TTTCTTCTCAAAGAGGATCAGTTATGTCTAACTAGACATCAAAATCATAAAATGACTAAA
GAATCGTTGAGCAAAAGAGACTTAATAGACCAGAATAAGGAAAATTACCATCAGTTGAAA
GCTTTGATAGTTCTTTTGAAGATAGTCCTAATAAGCATATTAGCGTACAGAGCGCTAGCA
GTCTTCAAAAATAAACATAAGAAGATAAGGATATGTAAAATGCTGTTTTAAATTAAGATT
TAAATAGACCTCACACAGGTTAGTTAAAAGAAAAGCTGCACTATAATAAACCTTTTGTGG
ATAAAGAAATTACGGAAAAATATGAAAAAGAGTTACAAAAACAAAATAAATAAAATATCT
AATAAATTGTAAATGATAGCTTTATTGATAAGGAGTTTTGTTCCTCTTCAGACGATGATA
AAAAGAGTAAATAAAATATTAAAAAATCAGATAAAAAATAAAATTTGGAAAACACATAAT
TCGAATTTATTCCTGTCCCTAAAGCTAAAGAATTAAAAGATTGGAATAATAAAATTTAAT
TAGATAATAGTGAACAATAATAATAATGCTCTGAAGAAGAAGAAGATGATAATAAGCTTG
GAGATGAATATTTTAAAAGCCAAACTATTAATCGTGGCTAGTTGGATTTACCTGATGATA
TGGGTGGAGCTGATGAAGAAGATGATAATAATTAAGATTATGATGAGGAAGAAGAAGAAG
AATAAAAGGAGGAAGAAGATGATTAATATTATTAAGAAGAAGATGATGAGGATGACTAAG
ATTAAAGTGAAAATAACTAAGATGACGATTAAGATATTTAATCTATTCCAGATTAAAATG
ATTGGTAAAAAGATGAGGAAGATGATGAGTATGAAGATGACTAAGAAAACGAATATGAAT
AGTAAGCTGCAGAGTAATATAGTAAAAACAAGTATGAATAGGATGAATATGAAGAATAAT
CTTACGAATAATCTACTTCAACAGATGTTTCCTCATAAAATAAAAGAGATATTAAGCAGA
AAATTTAGTAAAAGCTTTAAGCAAGACTAAAAAGACAAAATGAACTTTAGACTCTTTTAG
ATATAAAAGTTTCAGAATGCCATAAAGTTCTTGGTGAATAAAAGTTTAATGTGATTTTGC
AGTTCTTTAAAGATAAATTAAATGTAAGAATTTCAATCAAATATTAGATTATATTTAATT
ATATTTATTTATAAAAGTGTGAAAAAGAATTAACAGACGAAGATCAAGACGAAATAGATT
AAATGATGCAAGAAAATATGAAAAATATTACTAATAATCAAGTAATTTACTTTAAATTAA
ATATTTAAATTTTATAATTACCAAATATATTAGGTAATTCAAAATTTCTACAAAATTTTG
CATTTAGATATTGAGTTAGAAAAATGTAAAACCGATGTTAGAAGTATTTAAGAAAATATA
CAATAACTTTGA