Identifiers and Description

Gene Model Identifier

TTHERM_00265180

Standard Name

NRK16 (NIMA-Related Kinase)

Aliases

PreTt29473 | 23.m00369

Description

NIMA-Related Kinase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase
  • ( TIGR01387 ) heavy metal response regulator
  • ( PF00072 ) response regulator receiver domain
  • ( TIGR01818 ) nitrogen regulation protein NR(I)
  • ( TIGR02875 ) sporulation transcription factor Spo0A
  • ( TIGR02154 ) phosphate regulon transcriptional regulatory protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 14.4%

TetraMine Data

TTHERM_00265180

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06009.19.997093137033517e-262protein kinase domain-containi
ng protein (835 aa)
OxytrichaContig8286.0.g251.999765224767555e-159Protein kinase domain
Stentor CoeruleusSteCoe_217811.0648786602415064e-63
DictyBaseDDB_G02892772.0004062814618821e-57nek4 on chromosome: 5 position
2561379 to 2563106
WormBaseWBGene000226311.9997255150861791e-53locus:nekl-2 status:Confirme
d UniProt:O01775 protein_i
d:CCD64899.1
SGDYMR001C6.0018235484001396e-36CDC5 Polo-like kinase with mul
tiple functions in mitosis and
cytokinesis through substrate
phosphorylation, also functio
ns in adaptation to DNA damage
during meiosis; has similarit
y to Xenopus Plx1 and S. pombe
Plo1p; possible Cdc28p substr
ate

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16611747: Wloga D, Camba A, Rogowski K, Manning G, Jerka-Dziadosz M, Gaertig J (2006) Members of the NIMA-related kinase family promote disassembly of cilia by multiple mechanisms. Molecular biology of the cell 17(6):2799-810

Sequences

>TTHERM_00265180(coding)
ATGGCTGATAAATAATACATGAATATACATGTCCTCGTAGCAGAGGATGACAATTTCTAA
AGGTTAGCTCTTATAGACATTTTAACTCTATGCGATTATTAGGTCACTGCTGTGGAAAAT
GGCAGATTGGCTAGAGATGAGCTTCTGAAATAAGATTCAAATATTGACATAGTTTTATTA
GATTTATATATGCCAGAAATGGATGGATTTGAATTATTAAGTTTAATGCAAGAACATGAA
AATTTACAAAAGATTCCAGTTATCATGATGAGTTCAGATAAAGAAGAAGAAAAGGTGGCA
ACATGTATTGCAAAAGGAGCAAAAGATTACATATTCAAGCCACTAAGAGTACAAAATGTA
AAAGCTATTGCAAAATACGTACAGTACAAAGATTAAGGAGATAAAAATTCTAATCTAGTC
GGAATTTAATAATATAAGGTTCTTAAAACATTAGGTTAAGGTGCTTCAGGAAGCGTAGAG
TTAGTGTAAAAAAATGATGGAAATTTATATGCATTAAAGACTATATCCATGAAATATATG
AATGATACAGAAAAAAGATCTGCTCAATCAGAAGTTACTTTGCTAAAGGTCTTAGTTGCA
CCAACTATTATTCGTTATTATGAAGCATTTGTCTAAAATGATTCAATTTATATAGTTATG
GAATATGCAAAAGAAGGAGCCTTAAGCGATAAAATACAAGAGCATAAAACTAAAGGCATA
AGGATAGATGAAGAAACTATTCTTTACTTTACTGCATAGATCGTCATAGCTTTGTTCTTT
ATGCATTAAAAGAAAATTCTTCATAGAGATATTAAGTCTCAAAATCTTTTTTTAACTAAA
GAAAATGTAGTTAAGCTAGGAGACTTTGGTATTTCTAAAGCTCTTGGAACAAATGCTGAT
TTCACTAAAACCTTGGTAGGAACTCCTTATTTTATGTCTCCTGAAGTGTGTGCTGGTTAA
TCTTATGGAGACAAAGCAGATATTTGGGCTTTAGGTTGTACTCTATATGAAATGGTCATG
CTTCGTAGACCTTTTGATTGTGAAAATATAAACACTCTCTTTACTATGATCAGATAATAA
GACCCTTCTCCTTTGCACGATAACTGCAGTACAGACATTAGAATGCTAATTACTCTCATG
CTTAACAAAGATCCACTAAAAAGACCATTTATTTGGGATTTAGTAAACATTCCAATCATA
AATAAGAATATTAGAAAATATCATTAGCAAGAAGCTCCTGATGATCCCTTTTTGATAGAA
TTATTGAAAAGACCAACTTCAGGTAATCCTCTTTCAATGCCTAATACTCCATCCAACTCT
AACTCCTCCACTTAACCGCCAGCTAACTCTAACTCGGTAGCAAATAACAACTCAAATGTC
TCTAACAACCCATAAGAAGCATAATGTAATACTTTAGAATAAATTAGTAAGGCTATGAGT
GAAGAATTAAAACCTTACGACCAAAAAACAGGAATGTTTCATGTGGAAAGAAATGTAATC
AACGGAAAACAAATTTTTGATTGGTTTAATAAATATTATCCAAATTATCAAACTTCTCAG
CTTGTAGAATTACTCTAAAATTTAGTAGAAAAGAAGTATATTCATCATATATCAGGTCCA
CAGTATGAAGCAAATGTTAATTCATTATTCAGATTCTAATTTGATATGCCTGGTATACCT
TAAAACTATTACAAAATATGGAGCAAATAAGCAAGAGCACCTAGTGATATAATGTAAGAG
ATAATTTAATAGGCTAATTTCGTTCTCTAAGAAATTTGCGAATAATACACAGGAGTGATA
TCAGAAGATAAGCTTATCCAAAGTAAGAAATATACAAAATTCTAGGAAATGGTGTGTGAA
CTTCAAAAAATTTACTTGCAAGACCTTACTTAAGAAGATTAAAGAAAATCTTTCTTCTTG
AATCTGATTTAAATAATGTAATTTCACCAGTTTATGAAAGAAAAGTATGACCATAAAAGA
AATGAATAAAAAAAAAATGTATCAACAATTCTAGATTTGATCTAATCATTTCTTCCATTC
TTTAAAAAATAATAAAAATTTGAGTACAGAATTGGGCATTAAACTTTTTCTATAGAAGAT
GTGAAACATGGAATTCTAAGGTGTAATAAAAAGCATAAAGGAAGTAGCTTCCGTCCATTT
ACTGGAAGCGATGATAAATATCAGCTCATTTAATAGTAAGATTTAAGAGTTCTTATTCTT
TTTAAAGAAGAAAATGCTTCACCTTCACCTTTGCTTTTCATAACACCTGAAACATTTGAG
GAGCAACTGAATCAACTTTGTGCTAAATTTATGAGCAGATTTGTTTGCTATGATAGGGTT
GAGAACGATCTAACTTTGCATAAAATATTTTAAATATATCAAAATGACTTTGGAAAAGAT
TAATCTGATACAATAAAATGGGCTTCGAAATATACTAAGGGTATAGGAAATGTAAACGAT
CTCATATCAAGCATTTAACAAGGAGAAGTCTTTATATAATTCTAAGAAAAGTTTGAAATC
TGA


>TTHERM_00265180(protein)
MADKQYMNIHVLVAEDDNFQRLALIDILTLCDYQVTAVENGRLARDELLKQDSNIDIVLL
DLYMPEMDGFELLSLMQEHENLQKIPVIMMSSDKEEEKVATCIAKGAKDYIFKPLRVQNV
KAIAKYVQYKDQGDKNSNLVGIQQYKVLKTLGQGASGSVELVQKNDGNLYALKTISMKYM
NDTEKRSAQSEVTLLKVLVAPTIIRYYEAFVQNDSIYIVMEYAKEGALSDKIQEHKTKGI
RIDEETILYFTAQIVIALFFMHQKKILHRDIKSQNLFLTKENVVKLGDFGISKALGTNAD
FTKTLVGTPYFMSPEVCAGQSYGDKADIWALGCTLYEMVMLRRPFDCENINTLFTMIRQQ
DPSPLHDNCSTDIRMLITLMLNKDPLKRPFIWDLVNIPIINKNIRKYHQQEAPDDPFLIE
LLKRPTSGNPLSMPNTPSNSNSSTQPPANSNSVANNNSNVSNNPQEAQCNTLEQISKAMS
EELKPYDQKTGMFHVERNVINGKQIFDWFNKYYPNYQTSQLVELLQNLVEKKYIHHISGP
QYEANVNSLFRFQFDMPGIPQNYYKIWSKQARAPSDIMQEIIQQANFVLQEICEQYTGVI
SEDKLIQSKKYTKFQEMVCELQKIYLQDLTQEDQRKSFFLNLIQIMQFHQFMKEKYDHKR
NEQKKNVSTILDLIQSFLPFFKKQQKFEYRIGHQTFSIEDVKHGILRCNKKHKGSSFRPF
TGSDDKYQLIQQQDLRVLILFKEENASPSPLLFITPETFEEQLNQLCAKFMSRFVCYDRV
ENDLTLHKIFQIYQNDFGKDQSDTIKWASKYTKGIGNVNDLISSIQQGEVFIQFQEKFEI


>TTHERM_00265180(gene)
ATGGCTGATAAATAATACATGAATATACATGTCCTCGTAGCAGAGGATGACAATTTCTAA
AGGTTAGCTCTTATAGACATTTTAACTCTATGCGATTATTAGGTCACTGCTGTGGAAAAT
GGCAGATTGGCTAGAGATGAGCTTCTGAAATAAGATTCAAATATTGACATAGTTTTATTA
GATTTATATATGCCAGAAATGGATGGATTTGAATTATTAAGTTTAATGCAAGAACATGAA
AATTTACAAAAGATTCCAGTTATCATGATGAGTTCAGATAAAGAAGAAGAAAAGGTGGCA
ACATGTATTGCAAAAGGAGCAAAAGATTACATATTCAAGCCACTAAGAGTACAAAATGTA
AAAGGTAAATCAATAAATGTTAATTTATTTCTAAAAAGCGTTTTTCAAAATTTTCCTCTA
TTTTGATAAAATAACCAAATAGGGAAGTAAAATATTTGAATAGCCAAATCAAAAAGATTT
TAAAACAAGTATAATAAGAAAGTTTATATTTTTAAATTTAAGCTTATTAGGTGCTATTGT
TTTTTTATAAGCTGATTAGAAAAAAATAAGAAAATCAATAAATAATATATTTATTCGTTT
ATTAATTTTAAATAGCTATTGCAAAATACGTACAGTACAAAGATTAAGGAGATAAAAATT
CTAATCTAGTCGGAATTTAATAATATAAGGTTCTTAAAACATTAGGTTAAGGTGCTTCAG
GAAGCGTAGAGTTAGTGTAAAAAAATGATGGAAATTTATATGCATTAAAGACTATATCCA
TGAAATATATGAATGATACAGAAAAAAGATCTGCTCAATCAGAAGTTACTTTGCTAAAGG
TCTTAGTTGCACCAACTATTATTCGTTATTATGAAGCATTTGTCTAAAATGATTCAATTT
ATATGTAAATACAGCAAAAAATTATATAATTATGTCATAATTTATTTTTTTAAAATTTGA
TTAGAGTTATGGAATATGCAAAAGAAGGAGCCTTAAGCGATAAAATACAAGAGCATAAAA
CTAAAGGCATAAGGATAGATGAAGAAACTATTCTTTACTTTACTGCATAGATCGTCATAG
CTTTGTTCTTTATGCATTAAAAGAAAATTCTTCATAGAGATATTAAGTCTCAAAATCTTT
TTTTAACTAAAGAAAATGTAGTTAAGCTAGGAGACTTTGGTATTTCTAAAGCTCTTGGAA
CAAATGCTGATTTCACTAAAACCTTGGTAGGAACTCCTTATTTTATGTCTCCTGAAGTGT
GTGCTGGTTAATCTTATGGAGACAAAGCAGATATTTGGGCTTTAGGTTGTACTCTATATG
AAATGGTCATGCTTCGTAGACCTTTTGATTGTGAAAATATAAACACTCTCTTTACTATGA
TCAGATAATAAGTAATTAATTTTTTTATTTTAAGTATAAACTTTGACCAGTTTTAACATT
TGTTAATAGGACCCTTCTCCTTTGCACGATAACTGCAGTACAGACATTAGAATGCTAATT
ACTCTCATGCTTAACAAAGATCCACTAAAAAGACCATTTATTTGGGATTTAGTAAACATT
CCAATCATAAATAAGAATATTAGAAAATATCATTAGCAAGAAGCTCCTGATGATCCCTTT
TTGATAGAATTATTGAAAAGACCAACTTCAGGTAATCCTCTTTCAATGCCTAATACTCCA
TCCAACTCTAACTCCTCCACTTAACCGCCAGCTAACTCTAACTCGGTAGCAAATAACAAC
TCAAATGTCTCTAACAACCCATAAGAAGCATAATGTAATACTTTAGAATAAATTAGTAAG
GCTATGAGTGAAGAATTAAAACCTTACGACCAAAAAACAGGAATGTTTCATGTGGAAAGA
AATGTAATCAACGGAAAACAAATTTTTGATTGGTTTAATAAATATTATCCAAATTATCAA
ACTTCTCAGCTTGTAGAATTACTCTAAAATTTAGTAGAAAAGAAGTATATTCATCATATA
TCAGGTCCACAGTATGAAGCAAATGTTAATTCATTATTCAGATTCTAATTTGATATGCCT
GGTATACCTTAAAACTATTACAAAATATGGAGCAAATAAGCAAGAGCACCTAGTGATATA
ATGTAAGAGATAATTTAATAGGCTAATTTCGTTCTCTAAGAAGTAAAAAATGCATTAATT
AACTAACTAATTCATCTTTTATAAATATTTTTTACATTCTAATAAGATTTGCGAATAATA
CACAGGAGTGATATCAGAAGATAAGCTTATCCAAAGTAAGAAATATACAAAATTCTAGGA
AATGGTGTGTGAACTTCAAAAAATTTACTTGCAAGACCTTACTTAAGAAGATTAAAGAAA
ATCTTTCTTCTTGAATCTGATTTAAATAATGTAATTTCACCAGTTTATGAAAGAAAAGTA
TGACCATAAAAGAAATGAATAAAAAAAAAATGTATCAACAATTCTAGATTTGATCTAATC
ATTTCTTCCATTCTTTAAAAGTAAATTTAAAGAATAAAAAAATAAAGTTCAATAAAAAAT
ATTATTTTATTTATCTAAAAAGAATAATAAAAATTTGAGTACAGAATTGGGCATTAAACT
TTTTCTATAGAAGATGTGAAACATGGAATTCTAAGGTGTAATAAAAAGCATAAAGGAAGT
AGCTTCCGTCCATTTACTGGAAGCGATGATAAATATCAGCTCATTTAATAGTAAGATTTA
AGAGTTCTTATTCTTTTTAAAGAAGAAAATGCTTCACCTTCACCTTTGCTTTTCATAACA
CCTGAAACATTTGAGGAGCAACTGAATCAACTTTGTGCTAAATTTATGAGCAGATTTGTT
TGCTATGATAGGGTTGAGAACGATCTAACTTTGCATAAAATATTTTAAATATATCAAAAT
GACTTTGGAAAAGATTAATCTGATACAATAAAATGGGCTTCGAAATATACTAAGGGTATA
GGAAATGTAAACGATCTCATATCAAGCATTTAACAAGGAGAAGTCTTTATATAATTCTAA
GAAAAGTTTGAAATCTGA