Identifiers and Description

Gene Model Identifier

TTHERM_00260780

Standard Name

NRK15 (NIMA-Related Kinase)

Aliases

PreTt29341 | 23.m00237

Description

NIMA-Related Kinase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR01612 ) rhoptry protein
  • ( PF08251 ) Mastoparan peptide
  • ( PF08260 ) Insect kinin peptide
  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase
  • ( PF04702 ) Vicilin N terminal region
  • ( PF08729 ) Histone promoter control 2 (HPC2)
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF08619 ) Alkali metal cation/H+ antiporter Nha1

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00260780

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13672.19.997863464222902e-69protein kinase domain-containi
ng protein (942 aa)
OxytrichaContig18354.0.g518.999789881836428e-67Protein kinase domain
DictyBaseDDB_G02752412.000214949834694e-50nek3 on chromosome: 2 position
4983790 to 4987279
WormBaseWBGene000214613.00039543526891e-44locus:nekl-1 status:Partiall
y_confirmed UniProt:Q6AW07
protein_id:CCD69902.1
SGDYJL164C2.0006622580855403e-35TPK1 cAMP-dependent protein ki
nase catalytic subunit; promot
es vegetative growth in respon
se to nutrients via the Ras-cA
MP signaling pathway; inhibite
d by regulatory subunit Bcy1p
in the absence of cAMP; partia
lly redundant with Tpk2p and T
pk3p
Stentor CoeruleusSteCoe_328752.6786369618080778e-33

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16611747: Wloga D, Camba A, Rogowski K, Manning G, Jerka-Dziadosz M, Gaertig J (2006) Members of the NIMA-related kinase family promote disassembly of cilia by multiple mechanisms. Molecular biology of the cell 17(6):2799-810

Sequences

>TTHERM_00260780(coding)
ATGGATCAATTATTTAATTGTGTTAACTTACCTGGCGGCTATGTATTGAAAAAAAAAATA
GGTTAAGGTAATTATGGTTAAGTGTATTTGGTATAAAGTCAACGTGATGGTAGTATATTG
GCGATAAAAAATATTTCTACTCAAAATATGATCTTTGAGGATTTAGAAAAATGCTTAAAA
GAATGCACAATCCTACAGAAGCTTGATAATCCTCATATAGTTAAGTTCAAGAAGGCTATT
AATTAACCAAACAAATAAATGATTTATATCATGATGGAGTACGCAGAAGGTGGAGACTTA
AGAAAAAAAATAAAAGAATAGAAATAAACTGGAAAACTATTTGAAGAAGATTAAATCTTA
GATTGGTTTATTCAAATTTGCTTGGGCTTGAAGTATATTCATAAAAATAAAATAATTCAC
AGAGATATCAAACCTGAAAATATATTTTTAACTGCCGACAATAGAGTGAAGATTGGTGAT
TTCGGAATATCAAAAGAACTTGAATATACCAACCAATAGCTATATTCAAGAATTGGGACT
CCTTACTATTTAGCTCCAGAAATGATAAAAGGAGAACTTTATAATTCAAGCGTTGATATT
TGGTCTCTTGGTGTTGTTTTATATGAGCTGTGCTGTCTTAAACCTCCTTTTAATAGCTGG
AATGAATATATTATTTATTATAAAACTTATAAGAAACCCTATCCGCCTATTACTCAAGCT
TAATACTCACCCTAGCTTAAAACATTAATATCTAAACTCCTGATAAAATCCCCAGAAGGA
GAAAGAGGTCGTTATACTCTAGAGTAAATATTAAATGAACCCCTTATTAAAAATCGACTC
AAATAAAAATTTTTTTAAGGTAGAAAATAGTCTCCTTATGAATACTTTAAAGATAATAAT
AATAAAAATGTAAATAAAATATAGCAGCAGCATGTTTAAAACAATATTATTCAAGAAAAT
TTGATTCCAACTCCAGCTAAATTCTAAAATTTACAAAATAAAAAATAATAATTAAATGAT
ATTATGCCAAACATCTATCGTGCAAAGGATTATTCATAAGAATAATTCAAAAATTAATCG
GTTGATATGAGAAAATTAAATATATTTGGCCAAAAAGAGTAATCTAATCTTGGAAAAATA
AATGAAATTATGAGTTGTAAACCAAACTTTAAAAAATAATCAGATATTTTTGATAGAAAT
CTATCTAAACAACCAGTTAATGATCTAACAAAACAATAAAAGGCATATTTAAGTCCTAAT
ATTCATCTGAACAGAAATTAATTGAAAAACAATCAACAATAAGGACTTAATTAGTTAAAA
TAAGACAATAAGTAGAATACTTAATTTCAAAAATAGATTTTACCTAATCAGAAAGATCTT
TACACTGATATCCAGCTTGATTAAAGTCCTCGACAAATATTAAAAAATAAGAAAAAATAA
GGTGATGTGTAGTATGATTTAAATAAAGTAGAAGTAGCTAATCAAAATAATAATAATAAA
GAAGAAGAAGAATAAAATAGTAAAACTAAATAAGACTATGAGTAGACCACTTAATCTCAA
AAATAGATTTTACCTAATCAGAAAGATCTTTACACTGATATCCAGCTTGATTAAAGTCCT
CGACAAATATTAAAAAATAAGAAAAAATAAGGTGATGTCTAGTATGATTTAAATAAAGTA
GAAGTAGCTAATCAGAATAATAATAATGATAATAATAATAATAAAGAAGAAGAAGAATAA
AATAGTAAAACTAAATAAGACTATGAGTAGAGCACTTAATCTCAAAAATAGATTTTACAT
AATCAGAAAGATCTTCACACTAATACCCAGCTTTATTAAAGACCTCTACAAATATTAAAA
AATAAGAAAAAATAAGGTGATGTGTAAGATTTAAATAAAGTATAAGTAACTAATCTGAAT
AATAATAATAATAAAGAAGAAGAAGAAGAATAAAATAGTAAAACTAAATAAGACTATGAG
TAGAGCACTTAATCTCAAAAATAGATTTTACCTAATCAGAAAGATCTTCACACTGATATC
CAGCTTGATTAAAGTCCTCTAGAAATATTATAAAATGAGAAAAAATAAGTAGATATGTAA
GATTTAAATAAAGTAGAAGTAACTAATCAGAATAACAATAAAGAAGAATAAAATAATAAA
ACTCAATCTAATCTATCAATAAAGAGCTAAAAGACTTTTGAAACTAATAACAGCACTTAT
TTTTTTTAGTAAAGCAATGAAACCTACGAATCTGATACAATACCTGCCATTTAGAAAAAT
AATCTGTAAAATATCAATTTAATAGACTAAGTTTAAAATAAAACTAGATTGACATATAGA
AAAAAAAACAAAGATAGCAATGAGGAAGATCAAAAAAATAAAGAACCTATTTTTTATTAA
CCAAATAATCAACAATAAAAGCTGAAAAATAATGAATCAAATGACTAGGATTTTAAATTA
GAGCCTAAGATTTAGTCAACAACTGATTAAAGCAGCTAGAAACTACAAAAATAAACTCAA
ATAGACGAGGTATTTTAATCTCCAAATAATTCTACTTAAATCACTCAAAAAGGAAAAGAT
GATCAAAATTATCCTGTACGTATAACTGCTAAAGTAGTGAGTAAATGCAAAAATTAAATC
AGTGAACCAGAAAAATAAAATACTGAATTTGAAATAAAAACAAAATCAAATCCTAAATAA
GCTGATGAAATTCCAATTACTCCAATCAAACCAGGTTAAAAAGATTTGAATACAGAATTA
AATGATAATTCTCAAGAACAAAAAAATCTTTCTAAAACAAAAAGAAATATTTCTAAAGAA
TAGGAATTTAGCACTGCTGCTTCTTGCAAATTAATAACTTTAAATAAGGAGTAATCATTA
GAGAAGAATTCGTAAGATCCATATGAATTAAAAACTCATAATTAATCTTTGGGATAAGTT
ATTGAAGAAATGGAAGCGAAATCTAACAAAGATAATTAAGTAAATCGCAGAATCTCCTTT
GAAAGTGCTTTAAAATTATAAGATTAAGAAAACAACTCAAATAAAAAAACTCCTTAATAA
TTTAGCTTTTTTGATAATAACGAACAATAACTAAGCCCAAATTTAATTCAAAAAGAGCTG
TTGGATGATACATCTCAAAACAAATAAGAAAAAATTGACAACTATTTTTTTGAAGAAATT
GAAGAGGATATTTGCCCATACGAATAACCTGAAGAGGAATCTTAAAATGACATGAATACA
CGACTTACTTAATTGGAAAGTAAAACTGATCCAAGTAATCTCAAGGATACCAATAAAGAT
AATCAGAAAAATAAGCTTTAGGATAATTATCATTAACTAATAGATGATAAAAGCATGCAT
TGCGATGATAAAGAATCTGATGTCGAAGATTCTTTTTATGAAGAAGATCAAGAAGAAGAA
GAAGAAGATGATGAAGAAGAAGATAACATTTATATCATTCCAAGCAAATAATCTGAATCA
TTTAAAAAATTGAAGGTTAGTCTCTTATAAGACATGGATTAAGAGTAATTCTAACTATTT
TCAAACATAGTAAAAAAGGAGGTTGAAGAACGAACTATGTAATCTAGGGATCTAGAATTT
AATAATTTTAATATACCTGAGAGCTATTTATGGATAAAATAAATAGGCTATGGTTCATAG
GGTTAAGTGCATTTGATAGAAAGTAAAGAAGATAGTAGTAAATTGGCGATAAAAAATATA
TCTACTAAAAATATGAGCTAATAGTAGAAAAGAAAACACTAAGATGAATACAGATGCTTG
CAGAAGCTTGATCATATAGTTAAATTCAAGAAAGCCATTCATTGTATAAATAACTAAATG
ATTTAGATCATTATGGAGTACACAGAAGGCGGAGACTTACAAAAAGCAATAGAAAAGTAG
ATATAAATTGGAAAACCATTTGAAGAAGAGTAAATTTTAGATTGGTTTGCACAAATTTGC
TAGGGTTTGAAATATATTCACGAAAATAAAATAATTCACAGAGATATTAAACCTGCAAAT
TTATTTTTAACTGCATAGAATACAGTGAAAATTGGTGATTTCGGAGTAGCAAAAGAACAA
AAATATACCAACGAATAACTATCTTCATAAATTGGGACGCCTTACTATTTAGCTCCAGAA
ATTATAGATGGAAAACCATATAATTCAAGTGTTGATATTTGGTCTCTTGGTGTTGTTTTA
TATGAGCTGTGCTGTCTTAAACCTCCTTTTAATAGCTGGTGTGAAGCTGGTCTTTATTAT
AAAAGTAAAAATTTGCCCTATCCGCCTATTCAAGCTAAATACTCAAAAAAACTTAAAGAG
TTAATATCTAAACTCTTGAGAAAGTCCCCAGATGATCGTTATACTTTACAAGAAATATTA
GATGAGCCCTTTATTAAAAATCGACTCAAAAAAAAATCTTCTTCGAAAGATAGATAATAG
TCTCCTAATAAATTCTTTAATGATAATAAAAATATAAATTCTCTGTAACAAAATAAAAAA
GTAATTAACATTTTACCTGTTTAAAACAATATAATTCAACAAAATTTCATTCCAAACTCA
GCTAAATACTAAAATTTACAAGATAAAAAGTAATAATTAAATGATATTCGTCCAAATAGC
TGTCGTGCAAAAAAGGATTATGTATAAGAATAATAATAAAATGAATCTGTTGATAAGACA
AAAAATTTAAATATACTTGAAAAAGTAAATGTACCAATGAGTTGTAAACAAAATTCTTAA
AAATAATTAGATTAATTTGGCCAACAAGAGTAATCTAATTTTGAAAAAATTAATTTGGCC
AACAAGAATTAATTTGGCCAACAAGAGTAATCTAATTTTGAAAAAATAAATGTACCAATG
AGTTGTAAACAATAATCTTAAAAATAATAAAATAAATATATTTTAATTAAAAACCCATTC
ATACAACAAGTTAATGATTTAGCAAAACGATAAAATACAGATTCAACTTCTTACTTTTAA
TTGGACAGAAAATTATTGAAACGCTACCAACAATAAGGACTTAATTAGTTAAAATAAGTC
TATGAGTAAAGAAATTAATCTCTAAAACAGATTTTTCCTAATAGGAAAGATATTAATGTT
TTAAATAAAGCAGAAGTAACTGATGACAATAATAACAATAAAGAAGAAAATAATAAAACT
CCAGCTACTCAATCAATAAAGAATATAAAGACTTTTAAAACTTAAAACAGCGATTATTTC
AGTGGAAATAGTACTTAGTAAAGCAATGAAACATAGGAATCTGATAAAAAATCTGCCATT
TAGAAAAATAATCAAGGCTAAATTCAATCTAAACGTCGATTATCATAAAAAATAAAAAAC
ATAGCTAGAAATGAGGAAGATCAAAAAAATAAAGAAGCTATTTTTTTCTAACCAAATAAT
CAACAATAAAAACTGAATAATAATGAATCAAATTACTAGGATTTTAAATTAGAGCCTAAG
ATTCAGTCAACAACTGATTAAAGCAGTTAGAAACTACTAAAATAAATTCAAATAGACGAG
GTTAATTAATCTCCAAATAATTCTAGCTAAACCACTCAAAAAGTAAAAGATGATCAAAAT
TCACATGTAAGTATATTAAATGATTTTCACAATTTAATCCTTTATTTATTTATTTATTCA
TTCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACAAGAATAAAATAAA
TATGATGATATTAAATAGATGGAAACACCAAAATCACCTATTAAAACAATTAAAAGTAAT
GACTTTTGTACTTAATAAAATAATCTACCAGCTACAGTATACCTGAAAGATGTTGTATAA
TAAGAAGAAAAAAAAATAGATATCAATAAAGAAAATATAAATGAAAATAATTAGATAAAA
TACGAAGAAATTTAAATTACTAGAAGAATAACTGCAAAAGTAGTTAGTAAATGCAAAAAA
TAAGTCAGTGAACCAGAAAAATAAAACACTCAATGTGAAATAAAAACAAAATCGAACCCG
AAATAGGCTGATGAAACTCCAATTACTCCAATCAAATCAGATTAAAAAGATTTGAATACA
GAATTAAATGGTAATTCTCAAGAACAAAAAAATCTATCTAAAACAAAAGAAAATATTTCT
AAAGAATAAGAATTCAACAGTGCTGCTTCTTGCAAATTATTAACCGAAAAAAAAAATAAT
TTTGTAGCTAAGGAGTAATGTTAAGAGAAGAATTCTTAAGATCTATCTGAATAAAAAACT
CAAAAATAATCTTTAGGATAAATAATTGAAGAAGAGGATGAATTTGTTTCACAATCTAAC
AAAGAAAATTATATAATTCGCAGAATCTCCTTTGAAAGTGCTTTAAAATTATAAGATTAA
GAAAACAACTAAAATAAACAAACTCCTTAATAATTAAGCTTTTTTGAAAAAAACTAACAA
AATCTAACACCAGATTTACTTCAAAAAGAGTTGTTGGGTGAGAAATCTCAAAATAAATCA
GATTATTAGAAAAGTAAACTCATATATAGTCATCTTAAACTAATTCATGATGAAAACTTG
TATTATGATGATAAAAAATCCTATGACGGATATTATTATGAAGAAGATGAAGTAAAAAAA
AAATAAGAAGAAGAAGATGAAGAAAATATTTATATCATTCCAAGTAAATAATCAGAATAA
TTTAAAAAATAGAAGGTTAGTCTATTAAAAGACATGACGCAAGAGTAATTCTAACTATTT
TTCAACATAGTAAGAAAGGAGATATAGAATGAAAGATTCATAAATGATACAACAAAGAAC
TAAATAAATATTTTATAAACATAGATTCCCTAAGTTCAACTAGATAAATTGAATATTAAA
ATAAAATCATTTATTGATATTGTTAAGATAGAAAACTCTGATTTATAGATTGAAAATTTT
TGA


>TTHERM_00260780(protein)
MDQLFNCVNLPGGYVLKKKIGQGNYGQVYLVQSQRDGSILAIKNISTQNMIFEDLEKCLK
ECTILQKLDNPHIVKFKKAINQPNKQMIYIMMEYAEGGDLRKKIKEQKQTGKLFEEDQIL
DWFIQICLGLKYIHKNKIIHRDIKPENIFLTADNRVKIGDFGISKELEYTNQQLYSRIGT
PYYLAPEMIKGELYNSSVDIWSLGVVLYELCCLKPPFNSWNEYIIYYKTYKKPYPPITQA
QYSPQLKTLISKLLIKSPEGERGRYTLEQILNEPLIKNRLKQKFFQGRKQSPYEYFKDNN
NKNVNKIQQQHVQNNIIQENLIPTPAKFQNLQNKKQQLNDIMPNIYRAKDYSQEQFKNQS
VDMRKLNIFGQKEQSNLGKINEIMSCKPNFKKQSDIFDRNLSKQPVNDLTKQQKAYLSPN
IHLNRNQLKNNQQQGLNQLKQDNKQNTQFQKQILPNQKDLYTDIQLDQSPRQILKNKKKQ
GDVQYDLNKVEVANQNNNNKEEEEQNSKTKQDYEQTTQSQKQILPNQKDLYTDIQLDQSP
RQILKNKKKQGDVQYDLNKVEVANQNNNNDNNNNKEEEEQNSKTKQDYEQSTQSQKQILH
NQKDLHTNTQLYQRPLQILKNKKKQGDVQDLNKVQVTNLNNNNNKEEEEEQNSKTKQDYE
QSTQSQKQILPNQKDLHTDIQLDQSPLEILQNEKKQVDMQDLNKVEVTNQNNNKEEQNNK
TQSNLSIKSQKTFETNNSTYFFQQSNETYESDTIPAIQKNNLQNINLIDQVQNKTRLTYR
KKNKDSNEEDQKNKEPIFYQPNNQQQKLKNNESNDQDFKLEPKIQSTTDQSSQKLQKQTQ
IDEVFQSPNNSTQITQKGKDDQNYPVRITAKVVSKCKNQISEPEKQNTEFEIKTKSNPKQ
ADEIPITPIKPGQKDLNTELNDNSQEQKNLSKTKRNISKEQEFSTAASCKLITLNKEQSL
EKNSQDPYELKTHNQSLGQVIEEMEAKSNKDNQVNRRISFESALKLQDQENNSNKKTPQQ
FSFFDNNEQQLSPNLIQKELLDDTSQNKQEKIDNYFFEEIEEDICPYEQPEEESQNDMNT
RLTQLESKTDPSNLKDTNKDNQKNKLQDNYHQLIDDKSMHCDDKESDVEDSFYEEDQEEE
EEDDEEEDNIYIIPSKQSESFKKLKVSLLQDMDQEQFQLFSNIVKKEVEERTMQSRDLEF
NNFNIPESYLWIKQIGYGSQGQVHLIESKEDSSKLAIKNISTKNMSQQQKRKHQDEYRCL
QKLDHIVKFKKAIHCINNQMIQIIMEYTEGGDLQKAIEKQIQIGKPFEEEQILDWFAQIC
QGLKYIHENKIIHRDIKPANLFLTAQNTVKIGDFGVAKEQKYTNEQLSSQIGTPYYLAPE
IIDGKPYNSSVDIWSLGVVLYELCCLKPPFNSWCEAGLYYKSKNLPYPPIQAKYSKKLKE
LISKLLRKSPDDRYTLQEILDEPFIKNRLKKKSSSKDRQQSPNKFFNDNKNINSLQQNKK
VINILPVQNNIIQQNFIPNSAKYQNLQDKKQQLNDIRPNSCRAKKDYVQEQQQNESVDKT
KNLNILEKVNVPMSCKQNSQKQLDQFGQQEQSNFEKINLANKNQFGQQEQSNFEKINVPM
SCKQQSQKQQNKYILIKNPFIQQVNDLAKRQNTDSTSYFQLDRKLLKRYQQQGLNQLKQV
YEQRNQSLKQIFPNRKDINVLNKAEVTDDNNNNKEENNKTPATQSIKNIKTFKTQNSDYF
SGNSTQQSNETQESDKKSAIQKNNQGQIQSKRRLSQKIKNIARNEEDQKNKEAIFFQPNN
QQQKLNNNESNYQDFKLEPKIQSTTDQSSQKLLKQIQIDEVNQSPNNSSQTTQKVKDDQN
SHVSILNDFHNLILYLFIYSFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQEQNK
YDDIKQMETPKSPIKTIKSNDFCTQQNNLPATVYLKDVVQQEEKKIDINKENINENNQIK
YEEIQITRRITAKVVSKCKKQVSEPEKQNTQCEIKTKSNPKQADETPITPIKSDQKDLNT
ELNGNSQEQKNLSKTKENISKEQEFNSAASCKLLTEKKNNFVAKEQCQEKNSQDLSEQKT
QKQSLGQIIEEEDEFVSQSNKENYIIRRISFESALKLQDQENNQNKQTPQQLSFFEKNQQ
NLTPDLLQKELLGEKSQNKSDYQKSKLIYSHLKLIHDENLYYDDKKSYDGYYYEEDEVKK
KQEEEDEENIYIIPSKQSEQFKKQKVSLLKDMTQEQFQLFFNIVRKEIQNERFINDTTKN
QINILQTQIPQVQLDKLNIKIKSFIDIVKIENSDLQIENF


>TTHERM_00260780(gene)
ATGGATCAATTATTTAATTGTGTTAACTTACCTGGCGGCTATGTATTGAAAAAAAAAATA
GGTTAAGGTAATTATGGTTAAGTGTATTTGGTATAAAGTCAACGTGATGGTAGTATATTG
GCGATAAAAAATATTTCTACTCAAAATATGATCTTTGAGGATTTAGAAAAATGCTTAAAA
GAATGCACAATCCTACAGAAGCTTGATAATCCTCATATAGTTAAGTTCAAGAAGGCTATT
AATTAACCAAACAAATAAATGATTTATATCATGATGGAGTACGCAGAAGGTAAATTTTTA
TTTATTTAAATATGTTCTTACTCTTTCTAAATGAAAGATATTATTGTTAATTTTTTGATT
AGTATATTTTTTTGATATCCTATAAAGACCTAAATATTATTTAATTTAAATAATATTTGC
AATCAAACATATAAATAAATAAATATATTCATCATTAATTAAATAAAATAACACAAAGGT
GGAGACTTAAGAAAAAAAATAAAAGAATAGAAATAAACTGGAAAACTATTTGAAGAAGAT
TAAATCTTAGATTGGTTTATTCAAATTTGCTTGGGCTTGAAGTATATTCATAAAAAGTAT
AAAACTAATATATAAATAAATAGAATTAATTATAAATTTATTTATTTAACTAATTAAAAA
ATATTTTATAAAAAAGTAAAATAATTCACAGAGATATCAAACCTGAAAATATATTTTTAA
CTGCCGACAATAGAGTGAAGATTGGTGATTTCGGAATATCAAAAGAACTTGAATATACCA
ACCAATAGCTATATTCAAGAATTGGGACTCCTTACTATTTAGCTCCAGAAATGATAAAAG
GAGAACTTTATAATTCAAGCGTTGATATTTGGTCTCTTGGTGTTGTTTTATATGAGCTGT
GCTGTCTTAAACCTCCTTTTAATAGCTGGAATGAATATATTATTTATTATAAAACTTATA
AGAAACCCTATCCGCCTATTACTCAAGCTTAATACTCACCCTAGCTTAAAACATTAATAT
CTAAACTCCTGATAAAATCCCCAGAAGGAGAAAGAGGTCGTTATACTCTAGAGTAAATAT
TAAATGAACCCCTTATTAAAAATCGACTCAAATAAAAATTTTTTTAAGTAAATCAATATT
ATTTATTTATTTATTTACAAATATTTAAGCTAAATTTATTTCTTATTATTTTTTAGGGTA
GAAAATAGTCTCCTTATGAATACTTTAAAGATAATAATAATAAAAATGTAAATAAAATAT
AGCAGCAGCATGTTTAAAACAATATTATTCAAGAAAATTTGATTCCAACTCCAGCTAAAT
TCTAAAATTTACAAAATAAAAAATAATAATTAAATGATATTATGCCAAACATCTATCGTG
CAAAGGATTATTCATAAGAATAATTCAAAAATTAATCGGTTGATATGAGAAAATTAAATA
TATTTGGCCAAAAAGAGTAATCTAATCTTGGAAAAATAAATGAAATTATGAGTTGTAAAC
CAAACTTTAAAAAATAATCAGATATTTTTGATAGAAATCTATCTAAACAACCAGTTAATG
ATCTAACAAAACAATAAAAGGCATATTTAAGTCCTAATATTCATCTGAACAGAAATTAAT
TGAAAAACAATCAACAATAAGGACTTAATTAGTTAAAATAAGACAATAAGTAGAATACTT
AATTTCAAAAATAGATTTTACCTAATCAGAAAGATCTTTACACTGATATCCAGCTTGATT
AAAGTCCTCGACAAATATTAAAAAATAAGAAAAAATAAGGTGATGTGTAGTATGATTTAA
ATAAAGTAGAAGTAGCTAATCAAAATAATAATAATAAAGAAGAAGAAGAATAAAATAGTA
AAACTAAATAAGACTATGAGTAGACCACTTAATCTCAAAAATAGATTTTACCTAATCAGA
AAGATCTTTACACTGATATCCAGCTTGATTAAAGTCCTCGACAAATATTAAAAAATAAGA
AAAAATAAGGTGATGTCTAGTATGATTTAAATAAAGTAGAAGTAGCTAATCAGAATAATA
ATAATGATAATAATAATAATAAAGAAGAAGAAGAATAAAATAGTAAAACTAAATAAGACT
ATGAGTAGAGCACTTAATCTCAAAAATAGATTTTACATAATCAGAAAGATCTTCACACTA
ATACCCAGCTTTATTAAAGACCTCTACAAATATTAAAAAATAAGAAAAAATAAGGTGATG
TGTAAGATTTAAATAAAGTATAAGTAACTAATCTGAATAATAATAATAATAAAGAAGAAG
AAGAAGAATAAAATAGTAAAACTAAATAAGACTATGAGTAGAGCACTTAATCTCAAAAAT
AGATTTTACCTAATCAGAAAGATCTTCACACTGATATCCAGCTTGATTAAAGTCCTCTAG
AAATATTATAAAATGAGAAAAAATAAGTAGATATGTAAGATTTAAATAAAGTAGAAGTAA
CTAATCAGAATAACAATAAAGAAGAATAAAATAATAAAACTCAATCTAATCTATCAATAA
AGAGCTAAAAGACTTTTGAAACTAATAACAGCACTTATTTTTTTTAGTAAAGCAATGAAA
CCTACGAATCTGATACAATACCTGCCATTTAGAAAAATAATCTGTAAAATATCAATTTAA
TAGACTAAGTTTAAAATAAAACTAGATTGACATATAGAAAAAAAAACAAAGATAGCAATG
AGGAAGATCAAAAAAATAAAGAACCTATTTTTTATTAACCAAATAATCAACAATAAAAGC
TGAAAAATAATGAATCAAATGACTAGGATTTTAAATTAGAGCCTAAGGTAATAAAAACAA
AGTATTTTCACATTATCAAACTTATATTATTATATAAAAGATTTAGTCAACAACTGATTA
AAGCAGCTAGAAACTACAAAAATAAACTCAAATAGACGAGGTATTTTAATCTCCAAATAA
TTCTACTTAAATCACTCAAAAAGGAAAAGATGATCAAAATTATCCTGTACGTATAACTGC
TAAAGTAGTGAGTAAATGCAAAAATTAAATCAGTGAACCAGAAAAATAAAATACTGAATT
TGAAATAAAAACAAAATCAAATCCTAAATAAGCTGATGAAATTCCAATTACTCCAATCAA
ACCAGGTTAAAAAGATTTGAATACAGAATTAAATGATAATTCTCAAGAACAAAAAAATCT
TTCTAAAACAAAAAGAAATATTTCTAAAGAATAGGAATTTAGCACTGCTGCTTCTTGCAA
ATTAATAACTTTAAAGTAAATTAATTGTGAAGAAAAGTATTTATTAATTAATTTATTTAT
TTTATCATAAAGTAAGGAGTAATCATTAGAGAAGAATTCGTAAGATCCATATGAATTAAA
AACTCATAGTAAATTGAATTAAAAATAAATTTAATTTTTAGCTAAATAAATTAAAAATAC
TTTGTTAATTAATTAATAAATAAATAGATTAATCTTTGGGATAAGTTATTGAAGAAATGG
AAGCGAAATCTGTAAAATACTTTTAATTTTTTAAATTAAATTAAATTCTTTTCGTAAAAT
AAAGAACAAAGATAATTAAGTAAATCGCAGAATCTCCTTTGAAAGTGCTTTAAAATTATA
AGATTAAGAAAACAACTCAAATAAAAAAACTCCTTAATAATTTAGCTTTTTTGATAGTAA
ATAAGAAGATATTTAATTAATTTAGTTTAAATATTAAAATAGAATTATTAATATATTAAT
TAACTTTCATAAAAATATAAAAAAGATAACGAACAATAACTAAGCCCAAATTTAATTCAA
AAAGAGCTGTTGGATGATACATCTCAAAACAAATAAGAAAAAATTGACAACTATTTTTTT
GAAGAAATTGAAGAGGATATTTGCCCATACGAATAACCTGAAGAGGAATCTTAAAATGAC
ATGAATACACGACTTACTTAATTGGAAGTACTTTATTCTGAAAATAACTACACCTAATTT
TTACTATATTCAATTGTTTTAATAATGCATATTTCAATAAATCATTGAATTTAATTAGAG
TAAAACTGATCCAAGTAATCTCAAGGATACCAATAAAGATAATCAGAAAAATAAGCTTTA
GGATAATTATCATTAACTAATAGATGATAAAAGCATGCATTGCGATGATAAAGAATCTGA
TGTCGAAGATTCTTTTTATGAAGAAGATCAAGAAGAAGAAGAAGAAGATGATGAAGAAGA
AGATAACATTTATATCATTCCAAGCAAATAATCTGAATCATTTAAAGTAATTTTTTCATT
AAAATTCAAATTTATATTAATTTATTTATATTAAATTCATAAATAAAGAAATTGAAGGTT
AGTCTCTTATAAGACATGGATTAAGAGTAATTCTAACTATTTTCAAACATAGTAAAAAAG
GAGGTAAAATTTAAAAATATTTTTAAAAGAAGAAACTATTCAATCAAATATTTCAAATGA
TTTATTTATTAGTTTTTTGTTTATTTTAAAATAATTTTTTAAATAAGAATGATATTAGAT
ATGTTTTATCCATCTTCATCATATACTCAAATATATTTTATTATAAAATTAGATATAAAA
TGAGCGATTCTTAAATTATACACTTAAAAACTAAATAAATATTTTATAGACAAAGATTCC
CTAAGTTCAACTAGATAAATTGAAGTTAAAAATTAAATCATTTATTGATATTGTTTAGAT
AGAAAACTCTGATTTATAGATTGAAAATTTTTGATTTTTTTTCATGAATTAGTAAATTAC
ATTACATTACATAAATAAATAAATAAATGAATACATACATACATACATTACTAGTAGTAA
AAAATATTTGTTCCAAATAAAAATTTTTATTATATTTATTTCTACTTTAAATCACAAAAG
ATTTTGCTTACAAATATTTAGAAAGCCTCAACAGTAATTAATAAATAAATAATCAAATAA
ATTTGAATAAAAAAAAATAAATTAAAATTATTAATAAATTCTTGCTTGCTGCTTTTGTTT
TGAGATTTTGATTTATTATTTAAATTTTCAAAAAAATAATAAATTGTTTTAAACTCTATT
TAGTTTTAAATTGTGTTTGTTTCCCTTAGTAAATAATAAATAAAAAATAGGCGAATAATT
AAATATAAAAATTATATTTTTACTTTAATTTTTGGTTTAGTTTCTTCCTTTTACTTTCAA
TAAATTCTTTTGCTTAGATAGGTAGATACTTGAAGAGTGAATGAATGATTAATCTTTTTG
AATTTTTATTATTTGGTTGGATAATTAATTAAATGATTGATTAATTAATTCTTGATACTT
TCAATATAAATAGCAATAATATTTAAATTTAAAAAATAATCTATTCTTTATTTCTATTGG
GTGATATCATTTAAAAAGCTTAGCGATGATTGAAAAAGAGGATTTATAAATTAGAAATTT
AAAAAAGAGAATAATTTTTAGGCTGATCGATTTTAAGAAAAGTTTCTACTAAAATAATGT
AATATGTATAAAGTTTACTAAAACTCAAGTAAAATATTAATAAAAAAAGATCAGATAGAT
TAGAAATTTAAATCTTTTTCAAAAAATACTAATTAATTAATTAATTAATTAATTTCTTCA
AAAAGTCTAGCCTATTAAAGAAATCAACTTAGTTTATAATCCATTTAAAAGGTTGAAGAA
CGAACTATGTAATCTAGGGATCTAGAATTTAATAATTTTAATATACCTGAGAGCTATTTA
TGGATAAAATAAATAGGCTATGGTTCATAGGGTTAAGTGCATTTGATAGAAAGTAAAGAA
GATAGTAGTAAATTGGCGATAAAAAATATATCTACTAAAAATATGAGCTAATAGTAGAAA
AGAAAACACTAAGATGAATACAGATGCTTGCAGAAGCTTGATCATATAGTTAAATTCAAG
AAAGCCATTCATTGTATAAATAACTAAATGATTTAGATCATTATGGAGTACACAGAAGGT
AAATATTCAAAAATGTTCTCTTTAAATGAAAAAAAAATATTATGATTTATTTATTAATTT
TTTGATGAGTATATATTTTAGATAGATATTCTATAAAGACCTTAATATTATTAAATTCAT
TTATATAATATTTGTAATGAAATATACAAATATATTCATTCATTCATAAATAAATAAATA
CAAAGGCGGAGACTTACAAAAAGCAATAGAAAAGTAGATATAAATTGGAAAACCATTTGA
AGAAGAGTAAATTTTAGATTGGTTTGCACAAATTTGCTAGGGTTTGAAATATATTCACGA
AAAGTATTATAAATAAATAAATAAAATTATTAATCTATTTATTTATTTGATTAAAAAATA
TTTTATAAAAAAGTAAAATAATTCACAGAGATATTAAACCTGCAAATTTATTTTTAACTG
CATAGAATACAGTGAAAATTGGTGATTTCGGAGTAGCAAAAGAACAAAAATATACCAACG
AATAACTATCTTCATAAATTGGGACGCCTTACTATTTAGCTCCAGAAATTATAGATGGAA
AACCATATAATTCAAGTGTTGATATTTGGTCTCTTGGTGTTGTTTTATATGAGCTGTGCT
GTCTTAAACCTCCTTTTAATAGCTGGTGTGAAGCTGGTCTTTATTATAAAAGTAAAAATT
TGCCCTATCCGCCTATTCAAGCTAAATACTCAAAAAAACTTAAAGAGTTAATATCTAAAC
TCTTGAGAAAGTCCCCAGATGATCGTTATACTTTACAAGAAATATTAGATGAGCCCTTTA
TTAAAAATCGACTCAAAAAAAAATCTTCTTCGAAAGTAAATTAATATTATTTATTTTATT
ATAAATTTTTAAGCTAAATTTTATTTTCTTATTATTTTTAGGATAGATAATAGTCTCCTA
ATAAATTCTTTAATGATAATAAAAATATAAATTCTCTGTAACAAAATAAAAAAGTAATTA
ACATTTTACCTGTTTAAAACAATATAATTCAACAAAATTTCATTCCAAACTCAGCTAAAT
ACTAAAATTTACAAGATAAAAAGTAATAATTAAATGATATTCGTCCAAATAGCTGTCGTG
CAAAAAAGGATTATGTATAAGAATAATAATAAAATGAATCTGTTGATAAGACAAAAAATT
TAAATATACTTGAAAAAGTAAATGTACCAATGAGTTGTAAACAAAATTCTTAAAAATAAT
TAGATTAATTTGGCCAACAAGAGTAATCTAATTTTGAAAAAGTAAATGTACCAATAAGTT
GTAAACGAAATTCTTAAAAATAATTATTAGATTAATTTGGCCAACAAGAGTAATCTAATT
TTGAAAAAGTAAATGTACCAATGAGTTGTAAACGAAATTCTTAAAAATAATTAGATTAAT
TTGGCCAACAAGAGTAATCTAATTTTGAAAAAATAAATGTACCAATGAGTTGTAAACAAT
AATCTTAAAAATAATAAAATAAATATATTTTAATTAAAAACCCATTCATACAACAAGTTA
ATGATTTAGCAAAACGATAAAATACAGATTCAACTTCTTACTTTTAATTGGACAGAAAAT
TATTGAAACGCTACCAACAATAAGGACTTAATTAGTTAAAATAAGTCTATGAGTAAAGAA
ATTAATCTCTAAAACAGATTTTTCCTAATAGGAAAGATATTAATGTTTTAAATAAAGCAG
AAGTAACTGATGACAATAATAACAATAAAGAAGAAAATAATAAAACTCCAGCTACTCAAT
CAATAAAGAATATAAAGACTTTTAAAACTTAAAACAGCGATTATTTCAGTGGAAATAGTA
CTTAGTAAAGCAATGAAACATAGGAATCTGATAAAAAATCTGCCATTTAGAAAAATAATC
AAGGCTAAATTCAATCTAAACGTCGATTATCATAAAAAATAAAAAACATAGCTAGAAATG
AGGAAGATCAAAAAAATAAAGAAGCTATTTTTTTCTAACCAAATAATCAACAATAAAAAC
TGAATAATAATGAATCAAATTACTAGGATTTTAAATTAGAGCCTAAGGTAATCAAAATAA
AATATTTTCACATTTTCAAGCTTATATTATTATGTAAAAGATTCAGTCAACAACTGATTA
AAGCAGTTAGAAACTACTAAAATAAATTCAAATAGACGAGGTTAATTAATCTCCAAATAA
TTCTAGCTAAACCACTCAAAAAGTAAAAGATGATCAAAATTCACATGTAAGTATATTAAA
TGATTTTCACAATTTAATCCTTTATTTATTTATTTATTCATTCANNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNACAAGAATAAAATAAATATGATGATATTAAATAGAT
GGAAACACCAAAATCACCTATTAAAACAATTAAAAGTAATGACTTTTGTACTTAATAAAA
TAATCTACCAGCTACAGTATACCTGAAAGATGTTGTATAATAAGAAGAAAAAAAAATAGA
TATCAATAAAGAAAATATAAATGAAAATAATTAGATAAAATACGAAGAAATTTAAATTAC
TAGAAGAATAACTGCAAAAGTAGTTAGTAAATGCAAAAAATAAGTCAGTGAACCAGAAAA
ATAAAACACTCAATGTGAAATAAAAACAAAATCGAACCCGAAATAGGCTGATGAAACTCC
AATTACTCCAATCAAATCAGATTAAAAAGATTTGAATACAGAATTAAATGGTAATTCTCA
AGAACAAAAAAATCTATCTAAAACAAAAGAAAATATTTCTAAAGAATAAGAATTCAACAG
TGCTGCTTCTTGCAAATTATTAACCGAAAAAAAAAATAATTTTGTAGCGTAAATTAACTG
TGAAGAAAATTATTTAATTATTAATTTATTTATTATATCATAAAGTAAGGAGTAATGTTA
AGAGAAGAATTCTTAAGATCTATCTGAATAAAAAACTCAAAGTAAGTTGAATTAAAAATA
AATATTATAAATTTGTATTTCAGTTAATAAATTAAAATTACTTTATAAATAAATAAATAG
AATAATCTTTAGGATAAATAATTGAAGAAGAGGATGAATTTGTTTCACAATCTGTAATAT
ACTTTTTAATTTTAAATTAAATTCTTTTCATAAAATAAAGAACAAAGAAAATTATATAAT
TCGCAGAATCTCCTTTGAAAGTGCTTTAAAATTATAAGATTAAGAAAACAACTAAAATAA
ACAAACTCCTTAATAATTAAGCTTTTTTGAAAGTAAATAAAAAGATATTTAATTAATTTA
GTTTAAATATTGAAATAGAATTAACCAAAATAAAAATATAAAAAAGAAAACTAACAAAAT
CTAACACCAGATTTACTTCAAAAAGAGTTGTTGGGTGAGAAATCTCAAAATAAATCAGAT
TATTAGAAAAGTAAACTCATATATAGTCATCTTAAACTAATTCATGATGAAAACTTGTAT
TATGATGATAAAAAATCCTATGACGGATATTATTATGAAGAAGATGAAGTAAAAAAAAAA
TAAGAAGAAGAAGATGAAGAAAATATTTATATCATTCCAAGTAAATAATCAGAATAATTT
AAAGTAATTTTTTCATCAAAATTCAAATTTATATTTATTTATATTAAATTCATAAATAAA
GAAATAGAAGGTTAGTCTATTAAAAGACATGACGCAAGAGTAATTCTAACTATTTTTCAA
CATAGTAAGAAAGGAGGTAAAATTTAAATATATTTTAAAAAGAAGAAGAAATATTTCATA
TGATTTATTTATTAGTTTTTTTATTTATTTTAAAATAAGAACGATATTAGATATGTTTTA
TCCATCCTCATCATATACTCAAATATATTTTATTTTAAAATTAGATATAGAATGAAAGAT
TCATAAATGATACAACAAAGAACTAAATAAATATTTTATAAACATAGATTCCCTAAGTTC
AACTAGATAAATTGAATATTAAAATAAAATCATTTATTGATATTGTTAAGATAGAAAACT
CTGATTTATAGATTGAAAATTTTTGA