Identifiers and Description

Gene Model Identifier

TTHERM_00260770

Standard Name

NRK14 (NIMA-Related Kinase)

Aliases

PreTt29340 | 23.m00236

Description

NIMA-Related Kinase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF04935 ) Surfeit locus protein 6
  • ( PF07714 ) protein tyrosine kinase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00260770

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13672.13.0005221502158484e-68protein kinase domain-containi
ng protein (942 aa)
OxytrichaContig6078.0.1.g704.00060640795776e-64Protein kinase domain
DictyBaseDDB_G02892771.999534248571833e-46nek4 on chromosome: 5 position
2561379 to 2563106
WormBaseWBGene000214611.9991939848149086e-44locus:nekl-1 status:Partiall
y_confirmed UniProt:Q6AW07
protein_id:CCD69902.1
SGDYPL203W2.998863950472602e-38TPK2 cAMP-dependent protein ki
nase catalytic subunit; promot
es vegetative growth in respon
se to nutrients via the Ras-cA
MP signaling pathway; partiall
y redundant with Tpk1p and Tpk
3p; localizes to P-bodies duri
ng stationary phase
Stentor CoeruleusSteCoe_301952.1705220113036395e-29

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16611747: Wloga D, Camba A, Rogowski K, Manning G, Jerka-Dziadosz M, Gaertig J (2006) Members of the NIMA-related kinase family promote disassembly of cilia by multiple mechanisms. Molecular biology of the cell 17(6):2799-810

Sequences

>TTHERM_00260770(coding)
ATGTCATCTCAAAATCAATAATCTAATCATTTTAATATACCAGACGGCTATCGATGGATT
AAAAAAATAGGCGAAGGTGCATATGGTTAAGTGCATTTGGTGTAAAGCATTAGAGATGGT
AGTAAATGGGCGATAAAAAATATATATGTTAGTGGAGGTGAAGATGTGAAAAAAAAACGC
TAATCTGAATACAAAATCCTTAAGAAGCTTGATAATCCTCATATAATTAAGTTCAAGGAG
GCTATTAATTATAGAAATTAATAATTGATTTAGATCATTATGGAATACACAGATGGTGGA
GACTTAGAAAAACTAATAGAAAAATAAAAATAAAGTGCAAAACCATTTGAAGAAGAGAAA
ATTTTAGATTTTTTTATTCAAATTTGCTTGGGCTTGGATTGCATACACAAAAATAAAATA
ATTCATAGAGATATCAAACCTGCAAATATATTTTTAACTGCTTTTGGTTAATTGAAAATT
GGTGATTTCGGAGTATCAAAAGAACTTTAATACACTAAATAATGTCTAAAAACAATAGTT
GGGACTCCGTACTATATAGCTCCAGAAATTGTAAGTGGATATGCATATAATTCAAGTGTT
GATATTTGGTCTTTAGGTGTTATTCTATATTAGCTGTGTTGTCTTTAACCACCTTTTTAA
GACTGGAATGAAGCAAATCTTTACTGTAAAATTAAAAAAAAACCCTATCCACCTATAGCT
TAACTTTATTACTCAGGAAAACTTAAAACATTAATATCTAAACTCCTGAGAAAATGCCCA
AAGGAACGCTATACTTTAAAATAAATATTCGACGAATCTTTAATTTAAAGTAGACTCAAA
GTATACTTAAAAAAATCCATTTTAAATAGATCTCCTGATATACCTTAGGTAAATAATTTT
ATGGAGCAAGACTCATTATTGAATCAATTCATATAGAATGATCACTTGTAAGAAAATAGA
TAAGAAATTAACCAATAACCTGTTAATAGCAATGTAAATTAATAAAATATCAATCCAACT
TCTGCTAATAACTAAAATTTCGAAAGTAATAATAATTAATTAAATGAGCTTAGGCCATAA
AGTTGTGCCAATAGGTAAGCTTAAGAAGAATAAAAAAATGAATCTGCTGATAGGAGAAAA
AACTTACAAAAACTTGACAAATAAGAGTAATCAAATTTAGAAGAAAAAAATGCACAGAAT
AATAATAATAATAATAATATAGAAAATAATACAATTCCAGCTAGTCCATAAGTAAAGAAT
TTTAACACTTTAAAAAATGAAAATAACACTCATCTAAGTGGAAAGAGTACTTCATAAAGT
AGTTAAATATCGGACTTAGAAACACCTGTCGCAGAGAAAAAGGTGTAGCATTGTCGATCA
TCAGTTATAATAAAAATTAAAAACATTACTGATTAGAGAAATGAGTAAAATCAAAAAAGT
TAAGATAACCCTTTTATTTTACCAAATCAATAATAAAATAAAAAAGATAATCTTTAGTAG
TTTAAATCAAAATCAGTTATTGTATTCAATGAAAGAGATTTCTTTTGTAATAAATAAATA
TTGCCACCTCTAACATAAATACAAAAAATAGAAATCGAAAAAGAAAATGTAAATCAAAAT
CATTTGAATGAAGATTTATAAAAATAAATTTAAGTAAACAGAAAATATGAAAACATATTT
AGTACACATTAAAAATAAATCAGTGGCTTAGATAAATAAAATATTCAATATGAAAAAAAA
ATAAAATCGAACCTCAATTAGGTTGATAAATTCCCAATAACTCCAACCAAACCAGATTAA
AAAGATTTGAACACAAAATAAAATGGTAATTCTTAAGAACAAAAAAATATTTCTAAAGCA
AAAAGAAATAATTTTAATGAATAAGAATTCAACACTCATTCTTGTTAATTATTGACCGGA
AAAAAAAAAAATTTTGTAGATAAGGAGCAGTCACAAGAGAAGAATTCCAAGGTTCTATTT
GAATAAAAAACTCAAAATATTTGTCTTGAGAAATAATCGTCTAAAAATAACATGATTAGA
GAGCTAAATTAATTTTAAGTACCTTATTCAGAAGATGAATACATCAAATACCTGACGTGT
TTAATTTAAAGTGAACCAAATTATGTCAAAGAAACCTATAATGAGGAAGATTTACTTTAG
GAAAATGATCTTAAACTAATAGATGATGAAGATTTTTATTATGATGATTACTTTGAAGAA
GAAGAAGAAGAAGTAGAAGAAGAAGAAAAAATAAATAAATAACAAGAAAGAGATGTAGAA
AAGATTTATAACATTCCAAGATAATCACAAGAATAATTTAATTAATTGAAGGAAGATTTC
TTTAAAAAAATGACACAAGAGTAATTCAAACTACTTTACAACATAGTAAATAAGGAGATG
TAAAATTAAGACTTCTTAGATGATACACTAAAGAACTAAATAAAGATATTATAAAAAAAG
ATTCTCTCAGTTGAACTAGATGAATTAAAGTATAAAATATAATAATTAATTTATCTATTA
AGTTAAGATTGA


>TTHERM_00260770(protein)
MSSQNQQSNHFNIPDGYRWIKKIGEGAYGQVHLVQSIRDGSKWAIKNIYVSGGEDVKKKR
QSEYKILKKLDNPHIIKFKEAINYRNQQLIQIIMEYTDGGDLEKLIEKQKQSAKPFEEEK
ILDFFIQICLGLDCIHKNKIIHRDIKPANIFLTAFGQLKIGDFGVSKELQYTKQCLKTIV
GTPYYIAPEIVSGYAYNSSVDIWSLGVILYQLCCLQPPFQDWNEANLYCKIKKKPYPPIA
QLYYSGKLKTLISKLLRKCPKERYTLKQIFDESLIQSRLKVYLKKSILNRSPDIPQVNNF
MEQDSLLNQFIQNDHLQENRQEINQQPVNSNVNQQNINPTSANNQNFESNNNQLNELRPQ
SCANRQAQEEQKNESADRRKNLQKLDKQEQSNLEEKNAQNNNNNNNIENNTIPASPQVKN
FNTLKNENNTHLSGKSTSQSSQISDLETPVAEKKVQHCRSSVIIKIKNITDQRNEQNQKS
QDNPFILPNQQQNKKDNLQQFKSKSVIVFNERDFFCNKQILPPLTQIQKIEIEKENVNQN
HLNEDLQKQIQVNRKYENIFSTHQKQISGLDKQNIQYEKKIKSNLNQVDKFPITPTKPDQ
KDLNTKQNGNSQEQKNISKAKRNNFNEQEFNTHSCQLLTGKKKNFVDKEQSQEKNSKVLF
EQKTQNICLEKQSSKNNMIRELNQFQVPYSEDEYIKYLTCLIQSEPNYVKETYNEEDLLQ
ENDLKLIDDEDFYYDDYFEEEEEEVEEEEKINKQQERDVEKIYNIPRQSQEQFNQLKEDF
FKKMTQEQFKLLYNIVNKEMQNQDFLDDTLKNQIKILQKKILSVELDELKYKIQQLIYLL
SQD


>TTHERM_00260770(gene)
ATGTCATCTCAAAATCAATAATCTAATCATTTTAATATACCAGACGGCTATCGATGGATT
AAAAAAATAGGCGAAGGTGCATATGGTTAAGTGCATTTGGTGTAAAGCATTAGAGATGGT
AGTAAATGGGCGATAAAAAATATATATGTTAGTGGAGGTGAAGATGTGAAAAAAAAACGC
TAATCTGAATACAAAATCCTTAAGAAGCTTGATAATCCTCATATAATTAAGTTCAAGGAG
GCTATTAATTATAGAAATTAATAATTGATTTAGATCATTATGGAATACACAGATGGTAAA
TATTTAAAAATGTTATCTTGAAATGAAAGATATTTATTTCTTTTTTGCTTTTTTTATTAG
CTTATTTTTTAGATAATCTATAAAAACAAACCTCAATATTTAATTTATGTAATATTTGCA
ATCAAATATATAAAAAAATTAATAAATAAATATATAGGTGGAGACTTAGAAAAACTAATA
GAAAAATAAAAATAAAGTGCAAAACCATTTGAAGAAGAGAAAATTTTAGATTTTTTTATT
CAAATTTGCTTGGGCTTGGATTGCATACACAAAAAGTAAGTAGAAGAAATAAAATTATAG
TTTTATTTATTAAATAATCTTTTATAATAAAGTAAAATAATTCATAGAGATATCAAACCT
GCAAATATATTTTTAACTGCTTTTGGTTAATTGAAAATTGGTGATTTCGGAGTATCAAAA
GAACTTTAATACACTAAATAATGTCTAAAAACAATAGTTGGGACTCCGTACTATATAGCT
CCAGAAATTGTAAGTGGATATGCATATAATTCAAGTGTTGATATTTGGTCTTTAGGTGTT
ATTCTATATTAGCTGTGTTGTCTTTAACCACCTTTTTAAGACTGGAATGAAGCAAATCTT
TACTGTAAAATTAAAAAAAAACCCTATCCACCTATAGCTTAACTTTATTACTCAGGAAAA
CTTAAAACATTAATATCTAAACTCCTGAGAAAATGCCCAAAGGAACGCTATACTTTAAAA
TAAATATTCGACGAATCTTTAATTTAAAGTAGACTCAAAGTATACTTAAAAAAATCCATT
TTAGTAAATTAATATAAATTTTATTTATTAATTTTTAAGATATAATTTTTTTTTTCTTAT
TAATTTATAGAATAGATCTCCTGATATACCTTAGGTAAATAATTTTATGGAGCAAGACTC
ATTATTGAATCAATTCATATAGAATGATCACTTGTAAGAAAATAGATAAGAAATTAACCA
ATAACCTGTTAATAGCAATGTAAATTAATAAAATATCAATCCAACTTCTGCTAATAACTA
AAATTTCGAAAGTAATAATAATTAATTAAATGAGCTTAGGCCATAAAGTTGTGCCAATAG
GTAAGCTTAAGAAGAATAAAAAAATGAATCTGCTGATAGGAGAAAAAACTTACAAAAACT
TGACAAATAAGAGTAATCAAATTTAGAAGAAAAAAATGCACAGAATAATAATAATAATAA
TAATATAGAAAATAATACAATTCCAGCTAGTCCATAAGTAAAGAATTTTAACACTTTAAA
AAATGAAAATAACACTCATCTAAGTGGAAAGAGTACTTCATAAAGTAGTTAAATATCGGA
CTTAGAAACACCTGTCGCAGAGAAAAAGGTGTAGCATTGTCGATCATCAGTTATAATAAA
AATTAAAAACATTACTGATTAGAGAAATGAGTAAAATCAAAAAAGTTAAGATAACCCTTT
TATTTTACCAAATCAATAATAAAATAAAAAAGATAATCTTTAGTAGTTTAAATCAAAATC
AGTTATTGTATTCAATGAAAGAGATTTCTTTTGTAATAAATAAATATTGCCACCTCTAAC
ATAAATACAAAAAATAGAAATCGAAAAAGAAAATGTAAATCAAAATCATTTGAATGAAGA
TTTATAAAAATAAATTTAAGTAAACAGAAAATATGAAAACATATTTAGTACACATTAAAA
ATAAATCAGTGGCTTAGATAAATAAAATATTCAATATGAAAAAAAAATAAAATCGAACCT
CAATTAGGTTGATAAATTCCCAATAACTCCAACCAAACCAGATTAAAAAGATTTGAACAC
AAAATAAAATGGTAATTCTTAAGAACAAAAAAATATTTCTAAAGCAAAAAGAAATAATTT
TAATGAATAAGAATTCAACACTCATTCTTGTTAATTATTGACCGGAAAAAAAAAAAATTT
TGTAGAGTAAATTAATTGTGATGAAAGTTATTAAAATAATTTATTTTATCATAAAGTAAG
GAGCAGTCACAAGAGAAGAATTCCAAGGTTCTATTTGAATAAAAAACTCAAAGTAAATTA
AATTAAAAATATATTTTTTGAATTTAGTTTTTGTATATGAAGAAGATATTTGTCTTGAGA
AATAATCGTCTAAAAATAACATGATTAGAGAGCTAAATTAATTTTAAGTACCTTATTCAG
AAGATGAATACATCAAATACCTGACGTGTTTAGTATATTAAATTGTTTTAAAATAGCATT
TTGAAATAAACCATTGAATTTTATTTAGATTTAAAGTGAACCAAATTATGTCAAAGAAAC
CTATAATGAGGAAGATTTACTTTAGGAAAATGATCTTAAACTAATAGATGATGAAGATTT
TTATTATGATGATTACTTTGAAGAAGAAGAAGAAGAAGTAGAAGAAGAAGAAAAAATAAA
TAAATAACAAGAAAGAGATGTAGAAAAGATTTATAACATTCCAAGATAATCACAAGAATA
ATTTAATGTAGTTTTCATCAAAATTCCAATTTATATTTATTTATGTCCTATTCATAAATA
TAGTAATTGAAGGAAGATTTCTTTAAAAAAATGACACAAGAGTAATTCAAACTACTTTAC
AACATAGTAAATAAGGAGGTAAAATTAATTTAAAAATATTTTTAAAAGAAGAAAGTAATT
TTATTTTAAAAATTAGATGTAAAATTAAGACTTCTTAGATGATACACTAAAGAACTAAAT
AAAGATATTATAAAAAAAGATTCTCTCAGTTGAACTAGATGAATTAAAGTATAAAATATA
ATAATTAATTTATCTATTAAGTTAAGATTGA