Identifiers and Description

Gene Model Identifier

TTHERM_00312380

Standard Name

NRK13 (NIMA-Related Kinase)

Aliases

PreTt03425 | 30.m00234 | 3810.m01850

Description

NRK13 Serine/Threonine kinase domain protein; NIMA-Related Kinase- Protein kinase domain containing protein. Sequence similarity to the NEK protein kinase family (Eisen et al.- 2006).

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00312380

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03257.19.997093137033517e-262protein kinase domain-containi
ng protein (1151 aa)
OxytrichaContig22041.0.g312.0005752503420762e-105Protein kinase domain
DictyBaseDDB_G02752413.0000115468388957e-66nek3 on chromosome: 2 position
4983790 to 4987279
WormBaseWBGene000214615.002488024924283e-58locus:nekl-1 status:Partiall
y_confirmed UniProt:Q6AW07
protein_id:CCD69902.1
SGDYAR018C9.004005705510192e-49KIN3 Nonessential serine/threo
nine protein kinase; possible
role in DNA damage response
Stentor CoeruleusSteCoe_348375.5210822770285325e-42

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16611747: Wloga D, Camba A, Rogowski K, Manning G, Jerka-Dziadosz M, Gaertig J (2006) Members of the NIMA-related kinase family promote disassembly of cilia by multiple mechanisms. Molecular biology of the cell 17(6):2799-810

Sequences

>TTHERM_00312380(coding)
ATGGCTCAAAAAGAATATAAAAAACTTTACAAAGAAATTGAGGTCATTGGCAGAGGCAAT
TTCGGCTCAGCAACATTAGTTGAAAAATTAGACAATAAAAAGTAATATATAGCAAAGAAA
ATAGTTCTTAGTAGTTTAAACCCTAAGTAATAAGATAGTGCTCTTCAAGAAGCATAGTTG
TTGAAGGATTTAAATCATAAAAATATAGTCTCATATATAGAAAGCTTTAAAGAAGAAGAC
TTATTAATAATTATCATGGAGTATTGCGAGCATGGAGATTTAGCGTTTCATATTAAGAGA
AAGAAACAAAAGAAAGAGTATTTTCCTGAAATGTTAATCGTTAACTGGTTCTATGAACTA
GCACTTTCTATAAAATATATACACGAAAAAAAGATTTTGCATAGAGACATCAAAACTTCA
AATATTTTTATTACCAGAGACGGTACTATTAAAATTGGCGATTTTGGTATATCTAAAGTG
TTAGAAAACACCACTTCAGTGGCAAATACAGTGGTAGGCACTCCTTACTACATGAGTCCA
GAAGTTTGTGAAAGCAAACCTTATACTTATAAATCTGATATTTGGGCTTTAGGCTGCGTT
TTATACGAGCTCTGTGCTCTCGAGCATGCATTTGAATCTAATAACCTCTTAGGACTTATA
TTTAAAATTGTTTAACAAAATATATCTGACATTCCTAGTTTCTATTCGAAAGAGCTTAAT
GATTTAATTCACAAGCTTTTAAATAAAAATGAGCAGGAGAGACCAGTTATCAATGATATA
CTTAATGACATAAGCACTTAAAAACTCTTTAAATAATATTTAGAAGTAAGAGTAGATCCT
TCACAGGTAAAATAAGATCAGCAAATAAGCCACTCAAAAAGGTCCTCAAACAATCACCAT
CATCACTAAGGCCTTTCGAACGTCAATGACGGGAAAGGTAACAGTACAAATAAAGAAAAC
AATGCACAAAACTAATTTATAATTACAGATAAAACTAACATTCCAAAAACTAACATGTAA
GATGGTACTACTTCTATATAGACTGTAGATAGTTAAATATATTAAATAAATAACTAACAG
CTTTAGAATGCTTAAAATCAACATCACCATGAACATAAAGAAGAACCAGAATATAAAATA
AAGGCTAAGATTATAAAAAGAAACGTTTACACTCCTGATACACTGACTAAAAACAATAGT
GAGCGCCCTAGTTCATAAATTTCTAATAGCAATACACATGCTCATTTAAAATAAGTTGGT
AATAGTAATAATACTAGTAATAACGTTAGCAACAATGTAAACAGTAATGCCAATACTAAT
TATACAAGCAACAATAATATTGCAATTAGTAATAATACGAATAACAATGATTTTAAGGAT
GGGACTCATGATGAATATTACCATGATGAAGATCTTAATACCTTCAAATCTCAAAGAAAT
AAATTTGATGAATCAACTGCTATCAAACATAACAATTTTATAAAGTAGGATTCTCCAGTA
ACATTATAAAAAGTTAAATCATAATCTACTTTCAACCATCAGTCTAAATTTAAGAAAGAG
GATGGCTCTAAGCAGTTTGATATGTTCTCATCTTCTAGAAATGCACCTCATTAACAAGCT
GCTTCTCAACCTCATAATATTATGGTAAATAGCTAAGGGAACTAAAGAAATTAACAGTAT
CAGAATATTTGTTAACAAATTGCATCTCATGAATAAACATACAATCAGCCAAGTTTTGTA
AAATAAACCCCAAAGTAGTTAGCATAACGTAAAAAAGAAGAAAAGACTAGACTTTAATAA
GAATAATTAACAGAATACACCAAATCTTAAATAAAAAACTCTATGATATCTCGTGAGCGT
TACATTCAAAATGTTTATGGCGAAAAGTTTTTATCAAATTAAAGTGTACTTAAATAATAT
GAAGAAAGTATTCACAAGTAGCAAAAGAATTTACATTTAGAACCTATTTAACTAAATAAT
ATGAATAATGCTAAGTAATTACTCAAAAATAACTTTATGAGCGATAGAAACTCGTCTCCA
ATTAATCGTCACTAATAGACTAACTTTATGATGGTTGAAACTCAATTCTAGTAAGACATC
CCAATACCTTCTATTAATGGACATAATCAAAGATCTCCTAATAGCTATAAGCAATAGATA
GATAATGTAAATATTTATTCTGAAATAGACTATCCCATAGAGACATCAGAGAAATTTGCA
GTATCTACTTAAATTAATCGCCGAAGAAACAACAATGGTTCCAAAAGCGATGTAGCATCA
TTAATTTAAGAAGATGATTAGTAAAAAGGCACTTATAATATGATTCATAGAAATGTACCA
AGCTATAAAAATTAGTTTGCTTTCCTTAATGGAGGTGTATAAAAAACATTTAAATTTCAC
ACATAATAAGACGAGCTAGCAGAAAGTGAGGTTTTAGATTAGCAGAATGTTTAAAATAAA
TTCAATCTAAATAAACAAAAAGCTAAAATACAACAAATGTAATAAGATTAAAGCACTCAT
GCACATTAATAAGGTGGAGTTAGCTATTCAAATACTCAATTTGAATCAGATTTAAATTTA
GATTAAATAAAAAACAACGAAACAATTTATCAAGACATCCCTCTGCCAAATGTTAAAAAA
ACAGATAGTGAGGCATTGTCTTCACCACATTAAAATAGTTTTGAGAGCTATTTTAGTAAG
GAAGAAATTACTGATTAAGTATAAGAAAATAGCAAATAATCATAAAATAATAAAGGTTTG
TAGTATAAAATTAAAACAAAATAGCTCCAATCTACCTTCAAACATGCTAAGTAGCAAAGA
TAAGAAACATAAGAAGATGAATATGATCAAGAATAGTTCGAAGATTATTTTAGTGATGAG
GATGCAGAAATGAAAAAACAGTTAAAATAAGCTTAAAATAGTAACAGCAATAACAACAAC
AGTAACAATAATAAAGAACAAAATAGAAAATCATCTAATTATTCAAATAGTAGCAATAAC
AACAATAATAATAACAAAAATAATCATTTAGAATCAATTGCAGAAAATGATTGTGAATAA
ACTTAATTTACCCCTTTGTAATCAATGATTGGACATTAGCAGGTATTAAATTTTCAGTAG
AGCGTACGAAAATAATCTAATGGAAAATCTTAGGTCACTAACTAAGATTCTTTAAAACAA
TCTAAAAATCTCCAACGTTAGAACTCTAGCAATTCAAATGATGATTTACCACCCTAGCGT
TTGAGCAATAATCAAAGTAGAAACTCTCCTAAAAACGCGAATGACAATAGCTTTAAAAAT
AATTCAAATCCATAAATGAATTTAAATCAAAGCAAGCTAATTAGTCTTAGAAAGAAGTGC
TAATAAAGTCTTGGAGACCATTTCGATAAAGTTTATGACATTATTTAAAAGTCAAACTAA
CAAAATATAAAAGATTAAAAAATGTTATAGATGCTTGTTGATATAGTAGGAAAATCAAAA
ATAAATGATTGCTTTGAGGTTGAATAGCTTATATTCATAGAAGAGGAAATGAGAAAAAAG
TGA


>TTHERM_00312380(protein)
MAQKEYKKLYKEIEVIGRGNFGSATLVEKLDNKKQYIAKKIVLSSLNPKQQDSALQEAQL
LKDLNHKNIVSYIESFKEEDLLIIIMEYCEHGDLAFHIKRKKQKKEYFPEMLIVNWFYEL
ALSIKYIHEKKILHRDIKTSNIFITRDGTIKIGDFGISKVLENTTSVANTVVGTPYYMSP
EVCESKPYTYKSDIWALGCVLYELCALEHAFESNNLLGLIFKIVQQNISDIPSFYSKELN
DLIHKLLNKNEQERPVINDILNDISTQKLFKQYLEVRVDPSQVKQDQQISHSKRSSNNHH
HHQGLSNVNDGKGNSTNKENNAQNQFIITDKTNIPKTNMQDGTTSIQTVDSQIYQINNQQ
LQNAQNQHHHEHKEEPEYKIKAKIIKRNVYTPDTLTKNNSERPSSQISNSNTHAHLKQVG
NSNNTSNNVSNNVNSNANTNYTSNNNIAISNNTNNNDFKDGTHDEYYHDEDLNTFKSQRN
KFDESTAIKHNNFIKQDSPVTLQKVKSQSTFNHQSKFKKEDGSKQFDMFSSSRNAPHQQA
ASQPHNIMVNSQGNQRNQQYQNICQQIASHEQTYNQPSFVKQTPKQLAQRKKEEKTRLQQ
EQLTEYTKSQIKNSMISRERYIQNVYGEKFLSNQSVLKQYEESIHKQQKNLHLEPIQLNN
MNNAKQLLKNNFMSDRNSSPINRHQQTNFMMVETQFQQDIPIPSINGHNQRSPNSYKQQI
DNVNIYSEIDYPIETSEKFAVSTQINRRRNNNGSKSDVASLIQEDDQQKGTYNMIHRNVP
SYKNQFAFLNGGVQKTFKFHTQQDELAESEVLDQQNVQNKFNLNKQKAKIQQMQQDQSTH
AHQQGGVSYSNTQFESDLNLDQIKNNETIYQDIPLPNVKKTDSEALSSPHQNSFESYFSK
EEITDQVQENSKQSQNNKGLQYKIKTKQLQSTFKHAKQQRQETQEDEYDQEQFEDYFSDE
DAEMKKQLKQAQNSNSNNNNSNNNKEQNRKSSNYSNSSNNNNNNNKNNHLESIAENDCEQ
TQFTPLQSMIGHQQVLNFQQSVRKQSNGKSQVTNQDSLKQSKNLQRQNSSNSNDDLPPQR
LSNNQSRNSPKNANDNSFKNNSNPQMNLNQSKLISLRKKCQQSLGDHFDKVYDIIQKSNQ
QNIKDQKMLQMLVDIVGKSKINDCFEVEQLIFIEEEMRKK


>TTHERM_00312380(gene)
ATGGCTCAAAAAGAATATAAAAAACTTTACAAAGAAATTGAGGTCATTGGCAGAGGCAAT
TTCGGTAAAATTTAACTATTAATTATTATTATTGTTTATTTGATACAATTTATATTTTTC
AAAAAAGGCTCAGCAACATTAGTTGAAAAATTAGACAATAAAAAGTAATATATAGCAAAG
AAAATAGTTCTTAGTAGTTTAAACCCTAAGTAATAAGATAGTGCTCTTCAAGAAGTATAT
TTATTGAATTTATTACCATATTATCTTTGCATCACGCATCAATAATATCACTAAAAAATT
TTAAATTATGAAGAGGAATAAATAAATATAAATAAGAATTAGTTTTATAAATGAGAGTTA
AAAGTTTGAAAATAAAGAATATATTATCTATATTAATAGGCATAGTTGTTGAAGGATTTA
AATCATAAAAATATAGTCTCATATATAGAAAGCTTTAAAGAAGAAGACTTATTAATAATT
ATCATGGAGTATTGCGAGCGTAAGCAGATTCAAATTTGTTTTTTTAGTGTTAGCAAAAAT
GATATCATTCATAAATAAATGCAAATAATCGAATAACTTCTTAGCTATTATCAATTACAT
AGCGCTTTAAAGGTAGTTTTTAAGTATTTTTATATTTTGTGAATATTTAGATGGAGATTT
AGCGTTTCATATTAAGAGAAAGAAACAAAAGAAAGAGTATTTTCCTGAAATGTTAATCGT
TAACTGGTTCTATGAACTAGCACTTTCTATAAAATATATACACGAAAAAAAGATTTTGCA
TAGAGACATCAAAACTTCAAATATTTTTATTACCAGAGACGGTACTATTAAAATTGGCGA
TTTTGGTATATCTAAAGTGTTAGAAAACACCACTTCAGTGGCAAATACAGTGGTAGGCAC
TCCTTACTACATGAGGTAAGTTTTTAATATAATTTAGTCAAATCTATTTAGTGATTAATT
ATGTATGGAGTTTTCTAACTGAAGTATATTTTCAAGTAAGAAATGAATCTAGTGAAGTAA
TTTAAACTAGCTTACAAAAAAATAAATTAATTTTGTATTTATTTCTCATGCTTTTCGTTT
TCAAATGCAGCAAATGCTAACATCAATAGCTATTAATTTTTTTTAAATTTGTTTAAAATA
ACTCTTTTAAATTTTTTACAATATGATATAGTCCAGAAGTTTGTGAAAGCAAACCTTATA
CTTATAAATCTGATATTTGGGCTTTAGGCTGCGTTTTATACGAGCTCTGTGCTCTCGAGG
TAAATCAAATCGTTTTCAAAATTTTTAGAATAGAAACTATTTATTTTCTTATCTATTTTA
AATATTTATTTTTCTACTAAATTTGCTTAAAAAAATATATTAATAAAGAAATAAATATTC
ATTCATTTTATCTGATAAAAAAAGCATGCATTTGAATCTAATAACCTCTTAGGACTTATA
TTTAAAATTGTTTAACAAAATATATCTGACATTCCTAGTTTCTATTCGAAAGAGCTTAAT
GATTTAATTCAGTAAGCAAACTACTTACTTAATTTTTATTTATTTAAAAATATTTAAAAA
TGATGATTTAATAATTAGTTTATTAGAAAATTTATGAAGCTAAATTTTTTTAATTTGTAA
GATTAAAAAACTATCAGTTAAAATATTAATTAATTAATTAAAAAAAGCAAGCTTTTAAAT
AAAAATGAGCAGGAGAGACCAGTTATCAATGATATACTTAATGACATAAGCACTTAAAAA
CTCTTTAAATAATATTTAGAAGTAAGAGTAGATCCTTCACAGGTAAAATAAGATCAGCAA
ATAAGCCACTCAAAAAGGTCCTCAAACAATCACCATCATCACTAAGGCCTTTCGAACGTC
AATGACGGGAAAGGTAACAGTACAAATAAAGAAAACAATGCACAAAACTAATTTATAATT
ACAGATAAAACTAACATTCCAAAAACTAACATGTAAGATGGTACTACTTCTATATAGACT
GTAGATAGTTAAATATATTAAATAAATAACTAACAGCTTTAGAATGCTTAAAATCAACAT
CACCATGAACATAAAGAAGAACCAGAATATAAAATAAAGGCTAAGATTATAAAAAGAAAC
GTTTACACTCCTGATACACTGACTAAAAACAATAGTGAGCGCCCTAGTTCATAAATTTCT
AATAGCAATACACATGCTCATTTAAAATAAGTTGGTAATAGTAATAATACTAGTAATAAC
GTTAGCAACAATGTAAACAGTAATGCCAATACTAATTATACAAGCAACAATAATATTGCA
ATTAGTAATAATACGAATAACAATGATTTTAAGGATGGGACTCATGATGAATATTACCAT
GATGAAGATCTTAATACCTTCAAATCTCAAAGAAATAAATTTGATGAATCAACTGCTATC
AAACATAACAATTTTATAAAGTAGGATTCTCCAGTAACATTATAAAAAGTTAAATCATAA
TCTACTTTCAACCATCAGTCTAAATTTAAGAAAGAGGATGGCTCTAAGCAGTTTGATATG
TTCTCATCTTCTAGAAATGCACCTCATTAACAGTAAATTTATACTTAAAATTTTATGTTT
ATAAGTTTTTATATAATTTAAGAGCTGCTTCTCAACCTCATAATATTATGGTAAATAGCT
AAGGGAACTAAAGAAATTAACAGTATCAGAATATTTGTTAACAAATTGCATCTCATGAAT
AAACATACAATCAGCCAAGTTTTGTAAAATAAACCCCAAAGTAGTTAGCATAACGTAAAA
AAGAAGAAAAGACTAGACTTTAATAAGAATAATTAACAGAATACACCAAATCTTAAATAA
AAAACTCTATGATATCTCGTGAGCGTTACATTCAAAATGTTTATGGCGAAAAGTTTTTAT
CAAATTAAAGTGTACTTAAATAATATGAAGAAAGTATTCACAAGTAGCAAAAGAATTTAC
ATTTAGAACCTATTTAACTAAATAATATGAATAATGCTAAGTAATTACTCAAAAATAACT
TTATGAGCGATAGAAACTCGTCTCCAATTAATCGTCACTAATAGACTAACGTAAATTATA
TTATATTTTATTTATTATTTTTTAAACAATATTTTCCATAAATAAGTTTATGATGGTTGA
AACTCAATTCTAGTAAGACATCCCAATACCTTCTATTAATGGGTAAATAATTCATTTATT
AGAAAACAAAATGCTTAAATGTATATTTTAATATTCTCAATAGACATAATCAAAGATCTC
CTAATAGCTATAAGCAATAGATAGATAATGTAAATATTTATTCTGAAATAGACTATCCCA
TAGAGACATCAGAGAAATTTGCAGTATCTACTTAAATTAATCGCCGAAGAAACAACAATG
GTTCCAAAAGCGATGTAGCATCATTAATTTAAGAAGATGATTAGTAAAAAGGCACTTATA
ATATGATTCATAGAAATGTACCAAGCTATAAAAATTAGTTTGCTTTCCTTAATGGAGGTG
TATAAAAAACATTTAAATTTCACACATAATAAGACGAGCTAGCAGAAAGTGAGGTTTTAG
ATTAGCAGAATGTTTAAAATAAATTCAATCTAAATAAACAAAAAGCTAAAATACAACAAA
TGTAATAAGATTAAAGCACTCATGCACATTAATAAGGTGGAGTTAGCTATTCAAATACTC
AATTTGAATCAGATTTAAATTTAGATTAAATAAAAAACAACGAAACAATTTATCAAGACA
TCCCTCTGCCAAATGTTAAAAAAACAGATAGTGAGGCATTGTCTTCACCACATTAAAATA
GTTTTGAGAGCTATTTTAGTAAGGAAGAAATTACTGATTAAGTATAAGAAAATAGCAAAT
AATCATAAAATAATAAAGGTTTGTAGTATAAAATTAAAACAAAATAGCTCCAATCTACCT
TCAAACATGCTAAGTAGCAAAGATAAGAAACATAAGAAGATGAATATGATCAAGAATAGT
TCGAAGATTATTTTAGTGATGAGGATGCAGAAATGAAAAAACAGTTAAAATAAGCTTAAA
ATAGTAACAGCAATAACAACAACAGTAACAATAATAAAGAACAAAATAGAAAATCATCTA
ATTATTCAAATAGTAGCAATAACAACAATAATAATAACAAAAATAATCATTTAGAATGTA
AAATTTTTAATAAAAATAAATTTGATTATATTAAAATTTAATAATTTAAAATTTTAGCAA
TTGCAGAAAATGATTGTGAATAAACTTAATTTACCCCTTTGTAATCAATGATTGGACATT
AGCAGGTATTAAATTTTCAGTAGAGCGTACGAAAATAATCTAATGGAAAATCTTAGGTCA
CTAACTAAGATTCTTTAAAACAATCTAAAAATCTCCAACGTTAGAACTCTAGCAATTCAA
ATGATGATTTACCACCCTAGCGTTTGAGCAATAATCAAAGTAGAAACTCTCCTAAAAACG
CGAATGACAATAGCTTTAAAAATAATTCAAATCCATAAATGAATTTAAATCAAAGCAAGC
TAATTAGTCTTAGAAAGAAGTGCTAATAAAGTCTTGGAGACCATTTCGATAAAGTTTATG
ACATTATTTAAAAGTCAAACTAACAAAATATAAAAGATTAAAAAGTAAATAAAATTAAAT
TGAATTATTTTAATATGCTTTTAAAAATTTTTTATTATTTTAAGATGTTATAGATGCTTG
TTGATATAGTAGGAAAATCAAAAATAAATGATTGCTTTGAGGTTGAATAGCTTATATTCA
TAGAAGAGGAAATGAGAAAAAAGTGA