Identifiers and Description

Gene Model Identifier

TTHERM_00312380

Standard Name

NRK13 (NIMA-Related Kinase)

Aliases

PreTt03425 | 30.m00234 | 3810.m01850

Description

NIMA-Related Kinase, Protein kinase domain containing protein. Sequence similarity to the NEK protein kinase family (Eisen et al., 2006)."

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00312380

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03257.19.997093137033517e-262protein kinase domain-containi
ng protein (1151 aa)
OxytrichaContig22041.0.g312.0005752503420762e-105Protein kinase domain
DictyBaseDDB_G02752413.0000115468388957e-66nek3 on chromosome: 2 position
4983790 to 4987279
WormBaseWBGene000214615.002488024924283e-58locus:nekl-1 status:Partiall
y_confirmed UniProt:Q6AW07
protein_id:CCD69902.1
SGDYAR018C9.004005705510192e-49KIN3 Nonessential serine/threo
nine protein kinase; possible
role in DNA damage response
Stentor CoeruleusSteCoe_348375.5210822770285325e-42

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16611747: Wloga D, Camba A, Rogowski K, Manning G, Jerka-Dziadosz M, Gaertig J (2006) Members of the NIMA-related kinase family promote disassembly of cilia by multiple mechanisms. Molecular biology of the cell 17(6):2799-810

Sequences

>TTHERM_00312380(coding)
ATGGCTCAAAAAGAATATAAAAAACTTTACAAAGAAATTGAGGTCATTGGCAGAGGCAAT
TTCGGCTCAGCAACATTAGTTGAAAAATTAGACAATAAAAAGTAATATATAGCAAAGAAA
ATAGTTCTTAGTAGTTTAAACCCTAAGTAATAAGATAGTGCTCTTCAAGAAGCATAGTTG
TTGAAGGATTTAAATCATAAAAATATAGTCTCATATATAGAAAGCTTTAAAGAAGAAGAC
TTATTAATAATTATCATGGAGTATTGCGAGCATGGAGATTTAGCGTTTCATATTAAGAGA
AAGAAACAAAAGAAAGAGTATTTTCCTGAAATGTTAATCGTTAACTGGTTCTATGAACTA
GCACTTTCTATAAAATATATACACGAAAAAAAGATTTTGCATAGAGACATCAAAACTTCA
AATATTTTTATTACCAGAGACGGTACTATTAAAATTGGCGATTTTGGTATATCTAAAGTG
TTAGAAAACACCACTTCAGTGGCAAATACAGTGGTAGGCACTCCTTACTACATGAGTCCA
GAAGTTTGTGAAAGCAAACCTTATACTTATAAATCTGATATTTGGGCTTTAGGCTGCGTT
TTATACGAGCTCTGTGCTCTCGAGCATGCATTTGAATCTAATAACCTCTTAGGACTTATA
TTTAAAATTGTTTAACAAAATATATCTGACATTCCTAGTTTCTATTCGAAAGAGCTTAAT
GATTTAATTCACAAGCTTTTAAATAAAAATGAGCAGGAGAGACCAGTTATCAATGATATA
CTTAATGACATAAGCACTTAAAAACTCTTTAAATAATATTTAGAAGTAAGAGTAGATCCT
TCACAGGTAAAATAAGATCAGCAAATAAGCCACTCAAAAAGGTCCTCAAACAATCACCAT
CATCACTAAGGCCTTTCGAACGTCAATGACGGGAAAGGTAACAGTACAAATAAAGAAAAC
AATGCACAAAACTAATTTATAATTACAGATAAAACTAACATTCCAAAAACTAACATGTAA
GATGGTACTACTTCTATATAGACTGTAGATAGTTAAATATATTAAATAAATAACTAACAG
CTTTAGAATGCTTAAAATCAACATCACCATGAACATAAAGAAGAACCAGAATATAAAATA
AAGGCTAAGATTATAAAAAGAAACGTTTACACTCCTGATACACTGACTAAAAACAATAGT
GAGCGCCCTAGTTCATAAATTTCTAATAGCAATACACATGCTCATTTAAAATAAGTTGGT
AATAGTAATAATACTAGTAATAACGTTAGCAACAATGTAAACAGTAATGCCAATACTAAT
TATACAAGCAACAATAATATTGCAATTAGTAATAATACGAATAACAATGATTTTAAGGAT
GGGACTCATGATGAATATTACCATGATGAAGATCTTAATACCTTCAAATCTCAAAGAAAT
AAATTTGATGAATCAACTGCTATCAAACATAACAATTTTATAAAGTAGGATTCTCCAGTA
ACATTATAAAAAGTTAAATCATAATCTACTTTCAACCATCAGTCTAAATTTAAGAAAGAG
GATGGCTCTAAGCAGTTTGATATGTTCTCATCTTCTAGAAATGCACCTCATTAACAAGCT
GCTTCTCAACCTCATAATATTATGGTAAATAGCTAAGGGAACTAAAGAAATTAACAGTAT
CAGAATATTTGTTAACAAATTGCATCTCATGAATAAACATACAATCAGCCAAGTTTTGTA
AAATAAACCCCAAAGTAGTTAGCATAACGTAAAAAAGAAGAAAAGACTAGACTTTAATAA
GAATAATTAACAGAATACACCAAATCTTAAATAAAAAACTCTATGATATCTCGTGAGCGT
TACATTCAAAATGTTTATGGCGAAAAGTTTTTATCAAATTAAAGTGTACTTAAATAATAT
GAAGAAAGTATTCACAAGTAGCAAAAGAATTTACATTTAGAACCTATTTAACTAAATAAT
ATGAATAATGCTAAGTAATTACTCAAAAATAACTTTATGAGCGATAGAAACTCGTCTCCA
ATTAATCGTCACTAATAGACTAACTTTATGATGGTTGAAACTCAATTCTAGTAAGACATC
CCAATACCTTCTATTAATGGACATAATCAAAGATCTCCTAATAGCTATAAGCAATAGATA
GATAATGTAAATATTTATTCTGAAATAGACTATCCCATAGAGACATCAGAGAAATTTGCA
GTATCTACTTAAATTAATCGCCGAAGAAACAACAATGGTTCCAAAAGCGATGTAGCATCA
TTAATTTAAGAAGATGATTAGTAAAAAGGCACTTATAATATGATTCATAGAAATGTACCA
AGCTATAAAAATTAGTTTGCTTTCCTTAATGGAGGTGTATAAAAAACATTTAAATTTCAC
ACATAATAAGACGAGCTAGCAGAAAGTGAGGTTTTAGATTAGCAGAATGTTTAAAATAAA
TTCAATCTAAATAAACAAAAAGCTAAAATACAACAAATGTAATAAGATTAAAGCACTCAT
GCACATTAATAAGGTGGAGTTAGCTATTCAAATACTCAATTTGAATCAGATTTAAATTTA
GATTAAATAAAAAACAACGAAACAATTTATCAAGACATCCCTCTGCCAAATGTTAAAAAA
ACAGATAGTGAGGCATTGTCTTCACCACATTAAAATAGTTTTGAGAGCTATTTTAGTAAG
GAAGAAATTACTGATTAAGTATAAGAAAATAGCAAATAATCATAAAATAATAAAGGTTTG
TAGTATAAAATTAAAACAAAATAGCTCCAATCTACCTTCAAACATGCTAAGTAGCAAAGA
TAAGAAACATAAGAAGATGAATATGATCAAGAATAGTTCGAAGATTATTTTAGTGATGAG
GATGCAGAAATGAAAAAACAGTTAAAATAAGCTTAAAATAGTAACAGCAATAACAACAAC
AGTAACAATAATAAAGAACAAAATAGAAAATCATCTAATTATTCAAATAGTAGCAATAAC
AACAATAATAATAACAAAAATAATCATTTAGAATCAATTGCAGAAAATGATTGTGAATAA
ACTTAATTTACCCCTTTGTAATCAATGATTGGACATTAGCAGGTATTAAATTTTCAGTAG
AGCGTACGAAAATAATCTAATGGAAAATCTTAGGTCACTAACTAAGATTCTTTAAAACAA
TCTAAAAATCTCCAACGTTAGAACTCTAGCAATTCAAATGATGATTTACCACCCTAGCGT
TTGAGCAATAATCAAAGTAGAAACTCTCCTAAAAACGCGAATGACAATAGCTTTAAAAAT
AATTCAAATCCATAAATGAATTTAAATCAAAGCAAGCTAATTAGTCTTAGAAAGAAGTGC
TAATAAAGTCTTGGAGACCATTTCGATAAAGTTTATGACATTATTTAAAAGTCAAACTAA
CAAAATATAAAAGATTAAAAAATGTTATAGATGCTTGTTGATATAGTAGGAAAATCAAAA
ATAAATGATTGCTTTGAGGTTGAATAGCTTATATTCATAGAAGAGGAAATGAGAAAAAAG
TGA


>TTHERM_00312380(protein)
MAQKEYKKLYKEIEVIGRGNFGSATLVEKLDNKKQYIAKKIVLSSLNPKQQDSALQEAQL
LKDLNHKNIVSYIESFKEEDLLIIIMEYCEHGDLAFHIKRKKQKKEYFPEMLIVNWFYEL
ALSIKYIHEKKILHRDIKTSNIFITRDGTIKIGDFGISKVLENTTSVANTVVGTPYYMSP
EVCESKPYTYKSDIWALGCVLYELCALEHAFESNNLLGLIFKIVQQNISDIPSFYSKELN
DLIHKLLNKNEQERPVINDILNDISTQKLFKQYLEVRVDPSQVKQDQQISHSKRSSNNHH
HHQGLSNVNDGKGNSTNKENNAQNQFIITDKTNIPKTNMQDGTTSIQTVDSQIYQINNQQ
LQNAQNQHHHEHKEEPEYKIKAKIIKRNVYTPDTLTKNNSERPSSQISNSNTHAHLKQVG
NSNNTSNNVSNNVNSNANTNYTSNNNIAISNNTNNNDFKDGTHDEYYHDEDLNTFKSQRN
KFDESTAIKHNNFIKQDSPVTLQKVKSQSTFNHQSKFKKEDGSKQFDMFSSSRNAPHQQA
ASQPHNIMVNSQGNQRNQQYQNICQQIASHEQTYNQPSFVKQTPKQLAQRKKEEKTRLQQ
EQLTEYTKSQIKNSMISRERYIQNVYGEKFLSNQSVLKQYEESIHKQQKNLHLEPIQLNN
MNNAKQLLKNNFMSDRNSSPINRHQQTNFMMVETQFQQDIPIPSINGHNQRSPNSYKQQI
DNVNIYSEIDYPIETSEKFAVSTQINRRRNNNGSKSDVASLIQEDDQQKGTYNMIHRNVP
SYKNQFAFLNGGVQKTFKFHTQQDELAESEVLDQQNVQNKFNLNKQKAKIQQMQQDQSTH
AHQQGGVSYSNTQFESDLNLDQIKNNETIYQDIPLPNVKKTDSEALSSPHQNSFESYFSK
EEITDQVQENSKQSQNNKGLQYKIKTKQLQSTFKHAKQQRQETQEDEYDQEQFEDYFSDE
DAEMKKQLKQAQNSNSNNNNSNNNKEQNRKSSNYSNSSNNNNNNNKNNHLESIAENDCEQ
TQFTPLQSMIGHQQVLNFQQSVRKQSNGKSQVTNQDSLKQSKNLQRQNSSNSNDDLPPQR
LSNNQSRNSPKNANDNSFKNNSNPQMNLNQSKLISLRKKCQQSLGDHFDKVYDIIQKSNQ
QNIKDQKMLQMLVDIVGKSKINDCFEVEQLIFIEEEMRKK


>TTHERM_00312380(gene)
ATGGCTCAAAAAGAATATAAAAAACTTTACAAAGAAATTGAGGTCATTGGCAGAGGCAAT
TTCGGTAAAATTTAACTATTAATTATTATTATTGTTTATTTGATACAATTTATATTTTTC
AAAAAAGGCTCAGCAACATTAGTTGAAAAATTAGACAATAAAAAGTAATATATAGCAAAG
AAAATAGTTCTTAGTAGTTTAAACCCTAAGTAATAAGATAGTGCTCTTCAAGAAGTATAT
TTATTGAATTTATTACCATATTATCTTTGCATCACGCATCAATAATATCACTAAAAAATT
TTAAATTATGAAGAGGAATAAATAAATATAAATAAGAATTAGTTTTATAAATGAGAGTTA
AAAGTTTGAAAATAAAGAATATATTATCTATATTAATAGGCATAGTTGTTGAAGGATTTA
AATCATAAAAATATAGTCTCATATATAGAAAGCTTTAAAGAAGAAGACTTATTAATAATT
ATCATGGAGTATTGCGAGCGTAAGCAGATTCAAATTTGTTTTTTTAGTGTTAGCAAAAAT
GATATCATTCATAAATAAATGCAAATAATCGAATAACTTCTTAGCTATTATCAATTACAT
AGCGCTTTAAAGGTAGTTTTTAAGTATTTTTATATTTTGTGAATATTTAGATGGAGATTT
AGCGTTTCATATTAAGAGAAAGAAACAAAAGAAAGAGTATTTTCCTGAAATGTTAATCGT
TAACTGGTTCTATGAACTAGCACTTTCTATAAAATATATACACGAAAAAAAGATTTTGCA
TAGAGACATCAAAACTTCAAATATTTTTATTACCAGAGACGGTACTATTAAAATTGGCGA
TTTTGGTATATCTAAAGTGTTAGAAAACACCACTTCAGTGGCAAATACAGTGGTAGGCAC
TCCTTACTACATGAGGTAAGTTTTTAATATAATTTAGTCAAATCTATTTAGTGATTAATT
ATGTATGGAGTTTTCTAACTGAAGTATATTTTCAAGTAAGAAATGAATCTAGTGAAGTAA
TTTAAACTAGCTTACAAAAAAATAAATTAATTTTGTATTTATTTCTCATGCTTTTCGTTT
TCAAATGCAGCAAATGCTAACATCAATAGCTATTAATTTTTTTTAAATTTGTTTAAAATA
ACTCTTTTAAATTTTTTACAATATGATATAGTCCAGAAGTTTGTGAAAGCAAACCTTATA
CTTATAAATCTGATATTTGGGCTTTAGGCTGCGTTTTATACGAGCTCTGTGCTCTCGAGG
TAAATCAAATCGTTTTCAAAATTTTTAGAATAGAAACTATTTATTTTCTTATCTATTTTA
AATATTTATTTTTCTACTAAATTTGCTTAAAAAAATATATTAATAAAGAAATAAATATTC
ATTCATTTTATCTGATAAAAAAAGCATGCATTTGAATCTAATAACCTCTTAGGACTTATA
TTTAAAATTGTTTAACAAAATATATCTGACATTCCTAGTTTCTATTCGAAAGAGCTTAAT
GATTTAATTCAGTAAGCAAACTACTTACTTAATTTTTATTTATTTAAAAATATTTAAAAA
TGATGATTTAATAATTAGTTTATTAGAAAATTTATGAAGCTAAATTTTTTTAATTTGTAA
GATTAAAAAACTATCAGTTAAAATATTAATTAATTAATTAAAAAAAGCAAGCTTTTAAAT
AAAAATGAGCAGGAGAGACCAGTTATCAATGATATACTTAATGACATAAGCACTTAAAAA
CTCTTTAAATAATATTTAGAAGTAAGAGTAGATCCTTCACAGGTAAAATAAGATCAGCAA
ATAAGCCACTCAAAAAGGTCCTCAAACAATCACCATCATCACTAAGGCCTTTCGAACGTC
AATGACGGGAAAGGTAACAGTACAAATAAAGAAAACAATGCACAAAACTAATTTATAATT
ACAGATAAAACTAACATTCCAAAAACTAACATGTAAGATGGTACTACTTCTATATAGACT
GTAGATAGTTAAATATATTAAATAAATAACTAACAGCTTTAGAATGCTTAAAATCAACAT
CACCATGAACATAAAGAAGAACCAGAATATAAAATAAAGGCTAAGATTATAAAAAGAAAC
GTTTACACTCCTGATACACTGACTAAAAACAATAGTGAGCGCCCTAGTTCATAAATTTCT
AATAGCAATACACATGCTCATTTAAAATAAGTTGGTAATAGTAATAATACTAGTAATAAC
GTTAGCAACAATGTAAACAGTAATGCCAATACTAATTATACAAGCAACAATAATATTGCA
ATTAGTAATAATACGAATAACAATGATTTTAAGGATGGGACTCATGATGAATATTACCAT
GATGAAGATCTTAATACCTTCAAATCTCAAAGAAATAAATTTGATGAATCAACTGCTATC
AAACATAACAATTTTATAAAGTAGGATTCTCCAGTAACATTATAAAAAGTTAAATCATAA
TCTACTTTCAACCATCAGTCTAAATTTAAGAAAGAGGATGGCTCTAAGCAGTTTGATATG
TTCTCATCTTCTAGAAATGCACCTCATTAACAGTAAATTTATACTTAAAATTTTATGTTT
ATAAGTTTTTATATAATTTAAGAGCTGCTTCTCAACCTCATAATATTATGGTAAATAGCT
AAGGGAACTAAAGAAATTAACAGTATCAGAATATTTGTTAACAAATTGCATCTCATGAAT
AAACATACAATCAGCCAAGTTTTGTAAAATAAACCCCAAAGTAGTTAGCATAACGTAAAA
AAGAAGAAAAGACTAGACTTTAATAAGAATAATTAACAGAATACACCAAATCTTAAATAA
AAAACTCTATGATATCTCGTGAGCGTTACATTCAAAATGTTTATGGCGAAAAGTTTTTAT
CAAATTAAAGTGTACTTAAATAATATGAAGAAAGTATTCACAAGTAGCAAAAGAATTTAC
ATTTAGAACCTATTTAACTAAATAATATGAATAATGCTAAGTAATTACTCAAAAATAACT
TTATGAGCGATAGAAACTCGTCTCCAATTAATCGTCACTAATAGACTAACGTAAATTATA
TTATATTTTATTTATTATTTTTTAAACAATATTTTCCATAAATAAGTTTATGATGGTTGA
AACTCAATTCTAGTAAGACATCCCAATACCTTCTATTAATGGGTAAATAATTCATTTATT
AGAAAACAAAATGCTTAAATGTATATTTTAATATTCTCAATAGACATAATCAAAGATCTC
CTAATAGCTATAAGCAATAGATAGATAATGTAAATATTTATTCTGAAATAGACTATCCCA
TAGAGACATCAGAGAAATTTGCAGTATCTACTTAAATTAATCGCCGAAGAAACAACAATG
GTTCCAAAAGCGATGTAGCATCATTAATTTAAGAAGATGATTAGTAAAAAGGCACTTATA
ATATGATTCATAGAAATGTACCAAGCTATAAAAATTAGTTTGCTTTCCTTAATGGAGGTG
TATAAAAAACATTTAAATTTCACACATAATAAGACGAGCTAGCAGAAAGTGAGGTTTTAG
ATTAGCAGAATGTTTAAAATAAATTCAATCTAAATAAACAAAAAGCTAAAATACAACAAA
TGTAATAAGATTAAAGCACTCATGCACATTAATAAGGTGGAGTTAGCTATTCAAATACTC
AATTTGAATCAGATTTAAATTTAGATTAAATAAAAAACAACGAAACAATTTATCAAGACA
TCCCTCTGCCAAATGTTAAAAAAACAGATAGTGAGGCATTGTCTTCACCACATTAAAATA
GTTTTGAGAGCTATTTTAGTAAGGAAGAAATTACTGATTAAGTATAAGAAAATAGCAAAT
AATCATAAAATAATAAAGGTTTGTAGTATAAAATTAAAACAAAATAGCTCCAATCTACCT
TCAAACATGCTAAGTAGCAAAGATAAGAAACATAAGAAGATGAATATGATCAAGAATAGT
TCGAAGATTATTTTAGTGATGAGGATGCAGAAATGAAAAAACAGTTAAAATAAGCTTAAA
ATAGTAACAGCAATAACAACAACAGTAACAATAATAAAGAACAAAATAGAAAATCATCTA
ATTATTCAAATAGTAGCAATAACAACAATAATAATAACAAAAATAATCATTTAGAATGTA
AAATTTTTAATAAAAATAAATTTGATTATATTAAAATTTAATAATTTAAAATTTTAGCAA
TTGCAGAAAATGATTGTGAATAAACTTAATTTACCCCTTTGTAATCAATGATTGGACATT
AGCAGGTATTAAATTTTCAGTAGAGCGTACGAAAATAATCTAATGGAAAATCTTAGGTCA
CTAACTAAGATTCTTTAAAACAATCTAAAAATCTCCAACGTTAGAACTCTAGCAATTCAA
ATGATGATTTACCACCCTAGCGTTTGAGCAATAATCAAAGTAGAAACTCTCCTAAAAACG
CGAATGACAATAGCTTTAAAAATAATTCAAATCCATAAATGAATTTAAATCAAAGCAAGC
TAATTAGTCTTAGAAAGAAGTGCTAATAAAGTCTTGGAGACCATTTCGATAAAGTTTATG
ACATTATTTAAAAGTCAAACTAACAAAATATAAAAGATTAAAAAGTAAATAAAATTAAAT
TGAATTATTTTAATATGCTTTTAAAAATTTTTTATTATTTTAAGATGTTATAGATGCTTG
TTGATATAGTAGGAAAATCAAAAATAAATGATTGCTTTGAGGTTGAATAGCTTATATTCA
TAGAAGAGGAAATGAGAAAAAAGTGA